[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55320.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->142 3e6mD PDBj 8e-11 31.3 %
:RPS:PDB   27->146 2a61A PDBj 7e-11 22.7 %
:RPS:SCOP  36->146 2ethA1  a.4.5.28 * 3e-15 19.1 %
:HMM:SCOP  8->148 1jgsA_ a.4.5.28 * 1.3e-23 30.9 %
:HMM:PFM   43->95 PF01047 * MarR 2.9e-11 39.6 53/59  
:BLT:SWISS 36->145 YFIV_BACSU 2e-08 29.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55320.1 GT:GENE BAD55320.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(493598..494080) GB:FROM 493598 GB:TO 494080 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55320.1 LENGTH 160 SQ:AASEQ MWVRHAAVTRTDDTVVDLVVAASRLTRLAGAIADDDLPRATARALAVLDEHDAVRVSEFARNYGSSQPAATALLGRLVDAGYASRSKDPADSRAVVVALTPAGRERLARVRAAYGTAMTARLADGIDPERLRSAHDVMTELLAALSTPAPRPDPSRTPHP GT:EXON 1|1-160:0| BL:SWS:NREP 1 BL:SWS:REP 36->145|YFIV_BACSU|2e-08|29.4|109/160| SEG 6->22|aavtrtddtvvdlvvaa| BL:PDB:NREP 1 BL:PDB:REP 26->142|3e6mD|8e-11|31.3|115/148| RP:PDB:NREP 1 RP:PDB:REP 27->146|2a61A|7e-11|22.7|119/142| HM:PFM:NREP 1 HM:PFM:REP 43->95|PF01047|2.9e-11|39.6|53/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 36->146|2ethA1|3e-15|19.1|110/140|a.4.5.28| HM:SCP:REP 8->148|1jgsA_|1.3e-23|30.9|136/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 30 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- --------------11111-11--11111111111121111---1-1------1--------1-------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 136 STR:RPRED 85.0 SQ:SECSTR #######################cHHHHHTTHHHHTccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHTTcccTTcEEEEE# DISOP:02AL 3-7, 146-160| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHcccEEEccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccc //