[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55328.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.3
:78 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->76 1wa8B1 a.25.3.1 * 2.1e-13 33.3 %
:RPS:PFM   2->67 PF06013 * WXG100 2e-04 32.3 %
:HMM:PFM   8->67 PF06013 * WXG100 8.3e-12 33.9 59/86  
:BLT:SWISS 1->69 PPE20_MYCTU 4e-05 29.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55328.1 GT:GENE BAD55328.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 502001..502237 GB:FROM 502001 GB:TO 502237 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55328.1 LENGTH 78 SQ:AASEQ MAGYIGECLDEVDAKVATLSGTGWEGVAAQAYVDAHVQWLAGARAFAEGVRDMSDAARVAHARYTRAVETNHKMFNGG GT:EXON 1|1-78:0| BL:SWS:NREP 1 BL:SWS:REP 1->69|PPE20_MYCTU|4e-05|29.0|69/100| RP:PFM:NREP 1 RP:PFM:REP 2->67|PF06013|2e-04|32.3|65/86|WXG100| HM:PFM:NREP 1 HM:PFM:REP 8->67|PF06013|8.3e-12|33.9|59/86|WXG100| HM:SCP:REP 1->76|1wa8B1|2.1e-13|33.3|75/0|a.25.3.1|1/1|EsxAB dimer-like| OP:NHOMO 5 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------4-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 78-79| PSIPRED cHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //