[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55334.1
DDBJ      :             putative cold shock protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:71 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->68 1c9oA PDBj 1e-08 29.2 %
:RPS:SCOP  1->68 1c9oA  b.40.4.5 * 5e-09 29.2 %
:HMM:SCOP  1->70 2es2A1 b.40.4.5 * 2.4e-05 31.3 %
:HMM:PFM   1->66 PF00313 * CSD 1.9e-07 31.7 63/67  
:BLT:SWISS 1->68 CSPC_BACSU 2e-04 30.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55334.1 GT:GENE BAD55334.1 GT:PRODUCT putative cold shock protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(506609..506824) GB:FROM 506609 GB:TO 506824 GB:DIRECTION - GB:PRODUCT putative cold shock protein GB:PROTEIN_ID BAD55334.1 LENGTH 71 SQ:AASEQ MERATVYRWNIRNGTGVLTRTDGSLAWFHLSTVDKGDVFTLSEGDPVDAEIENVPQGGYECRAVSVRRHVE GT:EXON 1|1-71:0| BL:SWS:NREP 1 BL:SWS:REP 1->68|CSPC_BACSU|2e-04|30.8|65/66| RP:PDB:NREP 1 RP:PDB:REP 1->68|1c9oA|1e-08|29.2|65/66| HM:PFM:NREP 1 HM:PFM:REP 1->66|PF00313|1.9e-07|31.7|63/67|CSD| RP:SCP:NREP 1 RP:SCP:REP 1->68|1c9oA|5e-09|29.2|65/66|b.40.4.5| HM:SCP:REP 1->70|2es2A1|2.4e-05|31.3|67/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 91.5 SQ:SECSTR cEEEEEEEEETTTTEEEEEETTEEEEEEEGGGccccccccccTTcEEEEEEEEETTE###EEEEEEEE### DISOP:02AL 1-2, 69-71| PSIPRED ccccEEEEEEcccccEEEEEccccEEEEEEcccccccEEEEccccccccEEcccccccEEEEEEEEEEccc //