[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55336.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:68 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->62 PF04149 * DUF397 2e-13 65.5 %
:HMM:PFM   8->62 PF04149 * DUF397 3.4e-27 51.9 54/56  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55336.1 GT:GENE BAD55336.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(507996..508202) GB:FROM 507996 GB:TO 508202 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55336.1 LENGTH 68 SQ:AASEQ MSADLSGAHWFKSTFSNAGGECVEIAHMDNGGVRVRDSKNPSGAVLTFTPAEWDAFLAGVRDGQFDRP GT:EXON 1|1-68:0| RP:PFM:NREP 1 RP:PFM:REP 7->62|PF04149|2e-13|65.5|55/55|DUF397| HM:PFM:NREP 1 HM:PFM:REP 8->62|PF04149|3.4e-27|51.9|54/56|DUF397| OP:NHOMO 70 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ----6-------------------------------4----455----------------BB--4524342---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 12-20, 64-68| PSIPRED cccccccccEEEccccccccccEEEEcccccEEEEEccccccccEEEEcHHHHHHHHHHHHccccccc //