[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55343.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  83/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.152.1
:168 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->153 2o4dA PDBj 4e-14 36.4 %
:RPS:PDB   3->160 3c1lB PDBj 3e-08 11.8 %
:RPS:SCOP  12->144 2gmyA1  a.152.1.3 * 3e-13 20.6 %
:HMM:SCOP  14->156 2o4dA1 a.152.1.3 * 1.9e-24 36.2 %
:HMM:PFM   30->102 PF02627 * CMD 6.4e-14 28.8 73/85  
:BLT:SWISS 18->142 YDFG_BACSU 7e-14 30.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55343.1 GT:GENE BAD55343.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 514153..514659 GB:FROM 514153 GB:TO 514659 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55343.1 LENGTH 168 SQ:AASEQ MSITTQQRDGSRLPNPQQLVPELGEIGAALFKATGNGTIPRTTIGLVQLRAGQLVGSTYLAILHAGNLRAAGETEERIAAVATWRDAPYFSDAERVALALVEAVLQPTAQGERVPEELYALATEYYDDKALATLAIAIGQVNFFVPLALIGQPLPGRAPAEQWTPVSA GT:EXON 1|1-168:0| BL:SWS:NREP 1 BL:SWS:REP 18->142|YDFG_BACSU|7e-14|30.1|123/100| SEG 96->105|valalveavl| BL:PDB:NREP 1 BL:PDB:REP 41->153|2o4dA|4e-14|36.4|110/140| RP:PDB:NREP 1 RP:PDB:REP 3->160|3c1lB|3e-08|11.8|152/177| HM:PFM:NREP 1 HM:PFM:REP 30->102|PF02627|6.4e-14|28.8|73/85|CMD| RP:SCP:NREP 1 RP:SCP:REP 12->144|2gmyA1|3e-13|20.6|131/147|a.152.1.3| HM:SCP:REP 14->156|2o4dA1|1.9e-24|36.2|138/0|a.152.1.3|1/1|AhpD-like| OP:NHOMO 99 OP:NHOMOORG 83 OP:PATTERN -------------------------------------------------------------------- -2--5-------------------------------1-11-212--------------------1-2131-------------------------------1--------------------------------------------1-------------------1--------------------------------------------11-1--2---1---------1-----------------------------------------------------------------------------------------------------------------------------------------------------------1----1---1-------------11--11--12--1---11-11111-----------------------------------------------------------------------211112-----11111111-11111111--11-------------1---------------------------------------1-----11-12-------------------------------------------------11--------------------------1------------------------------------1-------------------------------------------------------------------------------------11111-2----111--------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 160 STR:RPRED 95.2 SQ:SECSTR ##HHHHHHHHccccHHHHHTHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHccHHHHHHHcGGGcGccccHHHHHHHHHHHHHHHHHHcGGGccHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHTcccGGGTTTTc###### DISOP:02AL 162-163, 166-168| PSIPRED cccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc //