[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55345.1
DDBJ      :             putative DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  124/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:289 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   31->114 1b0nA PDBj 3e-07 16.7 %
:RPS:SCOP  31->81 1b0nA2  a.35.1.3 * 2e-07 23.5 %
:HMM:PFM   35->78 PF01381 * HTH_3 9.3e-08 32.6 43/55  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55345.1 GT:GENE BAD55345.1 GT:PRODUCT putative DNA-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(516162..517031) GB:FROM 516162 GB:TO 517031 GB:DIRECTION - GB:PRODUCT putative DNA-binding protein GB:PROTEIN_ID BAD55345.1 LENGTH 289 SQ:AASEQ MANRTDLAAFLRARRADLQPSDVGLPQTGPRRTPGLRRQEVAQLAGISVEYYVRLEQARGPHPSAQVVGALARALMLTADERNYLFRTAGHPPPVVAGPDRTVSPAVRTILDGLTTMPAYVVDASYDILAWNAMAVFFISDLTDTPESDRNMVRWAFRRPADDPSWSDPETLQFATTTVADLRAAYARYPGNPRLSALVTELLGTSTRFAEMWAAQDVAERRNHRKCVTHPDLGVLEFDCQVLHLPDSDQRIIVYCADSGSPTEAVFRELAEGTRPLVPLALPGSERRS GT:EXON 1|1-289:0| SEG 4->18|rtdlaaflrarradl| RP:PDB:NREP 1 RP:PDB:REP 31->114|1b0nA|3e-07|16.7|84/103| HM:PFM:NREP 1 HM:PFM:REP 35->78|PF01381|9.3e-08|32.6|43/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 31->81|1b0nA2|2e-07|23.5|51/68|a.35.1.3| OP:NHOMO 297 OP:NHOMOORG 124 OP:PATTERN -------------------------------------------------------------------- ----J--1223---2------1---D------43334331-837B33--21-463--3--32--H-86E2--------------------------------------------------------------------------1------------------------------------------------2-------------------------------------33-------------------------1--------------------------------------------------------------------2------------------------------------------------1--------11311---21------------------------2--1--111-222--1--1-------------------1-1-11-1-----------------------------------11112233232-111122121111112221112--11-------------1-----1--------------------------------------11-1--------------------------------------1-----------1-----------------------1111-1-------------------------------22212-------------------2-------------------------------------1----------------------------1111----1--------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 29.4 SQ:SECSTR ##############################HHHTTccHHHHHHHHTccHHHHHHHHTTccccccHHHHHHHHHHHTccHHHHHccTTccccHHHHHHHHHHHHccccHHHHHHHc############################################################################################################################################################################## DISOP:02AL 1-3, 21-22, 25-27, 98-100, 279-282, 285-289| PSIPRED cccHHHHHHHHHHHHHHccHHHcccccccccccccccHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHccccccccccccEEHHHHccHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHHHcccccccccEEEEccccEEEEEEEEEEccccccccEEEEEEcccccHHHHHHHHHHHccccccHHHcccccccc //