[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55347.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  120/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
c.33.1
:212 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->157 1im5A PDBj 1e-08 33.1 %
:RPS:PDB   5->177 2a67A PDBj 1e-19 20.8 %
:RPS:SCOP  5->196 1nbaA  c.33.1.3 * 3e-21 17.2 %
:HMM:SCOP  1->187 1nbaA_ c.33.1.3 * 8.9e-42 37.6 %
:RPS:PFM   7->145 PF00857 * Isochorismatase 3e-15 41.5 %
:HMM:PFM   7->157 PF00857 * Isochorismatase 4.9e-34 31.3 147/174  
:BLT:SWISS 6->185 YRDC_BACSU 2e-08 24.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55347.1 GT:GENE BAD55347.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(517968..518606) GB:FROM 517968 GB:TO 518606 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55347.1 LENGTH 212 SQ:AASEQ MTTAHRALVVVDVQQEYFGGPLEVQHPPREETLANIVAAMDAAAAQNIPVAVVQHRSPEGAPVFVEGTPGWALRPEVAQRITPDTKHIHKVYGSVFAGTDLAEWLRKRGVDTITVVGYMTNNCDIATVVEAEGLGFAAEILADATGAIHLANEAGAVSAQVLHETLMVLFQSNLAAVAGTAEWVSALASGAPLGKSNLVASAQQGRSAAALV GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 6->185|YRDC_BACSU|2e-08|24.0|175/187| SEG 34->45|anivaamdaaaa| BL:PDB:NREP 1 BL:PDB:REP 7->157|1im5A|1e-08|33.1|148/179| RP:PDB:NREP 1 RP:PDB:REP 5->177|2a67A|1e-19|20.8|159/163| RP:PFM:NREP 1 RP:PFM:REP 7->145|PF00857|3e-15|41.5|135/173|Isochorismatase| HM:PFM:NREP 1 HM:PFM:REP 7->157|PF00857|4.9e-34|31.3|147/174|Isochorismatase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00857|IPR000868| GO:PFM GO:0008152|"GO:metabolic process"|PF00857|IPR000868| RP:SCP:NREP 1 RP:SCP:REP 5->196|1nbaA|3e-21|17.2|180/253|c.33.1.3| HM:SCP:REP 1->187|1nbaA_|8.9e-42|37.6|173/253|c.33.1.3|1/1|Isochorismatase-like hydrolases| OP:NHOMO 169 OP:NHOMOORG 148 OP:PATTERN ------------------------111-1--------------1--11----1--------------- --1-------1---1---------------------1-2--2--1----12-2-----------1-----------------1---------------------------------------------------------------------------------------------------------------111111121111121------111------------------------------1---------------------1--------------------------------------------------------1-----------------------------------------------1-----------1------------------------1------1---11-111-1111------------------------------1---------------------------------------1122231-----1112-----12111-----11--1---1-1-1-----11---------------1-----------111-121-111-1-----1-1---------------------------------------1111---1----1-------------------------------------------------------------------------------1------------------------------------1-1---------------11111-1--11-11111211-12221211--------------------1--1-----------------------------------------------------------------------1- -----1---------1--11---1-1-11-------1------1-111--1-12-1-----------------1-----------------------------1-1--------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 88.7 SQ:SECSTR ccTTcEEEEEEcccTTcccccccc#cTTHHHHHHHHHHHHHHHHHTTccEEEEEEccTTTcTTccTTcTTTcccTTccccHHTTcEEEEEccccTTTTccHHHHHHHTTccEEEEEEEcTTTHHHHHHHHHHHHTcEEEcTTcEEcccccccccccccHHHHHHHHHHHHcTTTcEEcTTTcEEcccHH####################### PSIPRED cccccEEEEEEcccHHHcccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccHHHHHHHHcccccEEEEcccccccccccHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHcccEEEEEcccccccccccccccccHHHHHHHHHHHHHHcccEEEEHHHHHHHHccccccccccHHHHHHHHHHHHccc //