[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55350.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.3
:99 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  3->97 1wa8B1 a.25.3.1 * 2e-16 27.5 %
:RPS:PFM   7->81 PF06013 * WXG100 1e-05 27.0 %
:HMM:PFM   5->86 PF06013 * WXG100 2e-13 28.4 81/86  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55350.1 GT:GENE BAD55350.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(521669..521968) GB:FROM 521669 GB:TO 521968 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55350.1 LENGTH 99 SQ:AASEQ MSSEFSVDLDHLDEIVTKLSALAAFIDERLDGIDGRIATLSGTGWESIAAQAYTEAHRQWSVSAREFVEGVKDLSDAAKKAHADLTYAVELNSNMLNGG GT:EXON 1|1-99:0| RP:PFM:NREP 1 RP:PFM:REP 7->81|PF06013|1e-05|27.0|74/86|WXG100| HM:PFM:NREP 1 HM:PFM:REP 5->86|PF06013|2e-13|28.4|81/86|WXG100| HM:SCP:REP 3->97|1wa8B1|2e-16|27.5|91/0|a.25.3.1|1/1|EsxAB dimer-like| OP:NHOMO 7 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------6-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //