[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55351.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.3
:112 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  11->105 1wa8B1 a.25.3.1 * 8.4e-13 29.7 %
:HMM:PFM   11->105 PF10824 * DUF2580 6.9e-20 30.5 95/100  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55351.1 GT:GENE BAD55351.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(521965..522303) GB:FROM 521965 GB:TO 522303 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55351.1 LENGTH 112 SQ:AASEQ MSDGGPPASATTLFVVPEKVGEVGKYLYELAQALQAALDSAAQDVSSLTDGSWTGDHATDFANAWADLRTSGDQIMAALTELAEKLGVTAHTYQARDENNAGAIQNSSLDLP GT:EXON 1|1-112:0| SEG 30->48|laqalqaaldsaaqdvssl| HM:PFM:NREP 1 HM:PFM:REP 11->105|PF10824|6.9e-20|30.5|95/100|DUF2580| HM:SCP:REP 11->105|1wa8B1|8.4e-13|29.7|91/0|a.25.3.1|1/1|EsxAB dimer-like| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //