[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55353.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  83/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.124.1
:254 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   96->243 1poiB PDBj 1e-13 28.8 %
:RPS:PDB   68->239 2ahuA PDBj 4e-19 15.3 %
:RPS:SCOP  67->231 1m3eA2  c.124.1.3 * 6e-22 20.0 %
:HMM:SCOP  4->251 1poiB_ c.124.1.3 * 2.1e-56 35.2 %
:HMM:PFM   95->212 PF01144 * CoA_trans 1.6e-08 18.5 108/218  
:BLT:SWISS 9->253 Y3582_MYCBO 3e-91 65.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55353.1 GT:GENE BAD55353.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(523514..524278) GB:FROM 523514 GB:TO 524278 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55353.1 LENGTH 254 SQ:AASEQ MMTTTETVTRAEYCAIACAEIFAGAGEIMASPMTPMATLGARLAKLTTEPDLLLSDGEALLLAETPPLGGKAPVEGWIPFRKVFDVVASGRRHVVMGANQIDRYGNQNLSAFGAHQQPSRQMFGVRGAPGNTINHPTSYWVARHSKRVFVDRVDIVCGVGYDKVDQDNPAFRFLHLHRVVTNLGVFDFEGPDHTMRARSLHPGVTPEEVAENTSFEVAGLGEAPQTRQPTAEELRIIREVLDPKKIREKEVPSS GT:EXON 1|1-254:0| BL:SWS:NREP 1 BL:SWS:REP 9->253|Y3582_MYCBO|3e-91|65.3|245/250| SEG 51->64|dlllsdgealllae| BL:PDB:NREP 1 BL:PDB:REP 96->243|1poiB|1e-13|28.8|146/260| RP:PDB:NREP 1 RP:PDB:REP 68->239|2ahuA|4e-19|15.3|163/505| HM:PFM:NREP 1 HM:PFM:REP 95->212|PF01144|1.6e-08|18.5|108/218|CoA_trans| RP:SCP:NREP 1 RP:SCP:REP 67->231|1m3eA2|6e-22|20.0|150/222|c.124.1.3| HM:SCP:REP 4->251|1poiB_|2.1e-56|35.2|244/260|c.124.1.3|1/1|NagB/RpiA/CoA transferase-like| OP:NHOMO 98 OP:NHOMOORG 85 OP:PATTERN -------1-----------------------1------------------------------------ --1-1---------11111-11--11111111111111231-------------------113--121-2------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1121---------1--------------------2--11---------------------2---------1----1-1------------------------------------------------------------12----------1-----------------1-2111----------------1-----------------------11------------1-1-1-1---------2------------------------------------1--------1------1------------------------------------------------------------1-------------------------------------------------------11-------------------------1-11111111-----1111--------------------------1-1-------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 69.3 SQ:SECSTR ###################################################################cccccccccEEccHHHHHHHHTTcccEEEEccEEETTccEEccEETTEEETTTTEEccTTHHHHHTTccEEEEEcccEEcccEEEEccccEEEEEcEccccccccHHHHHEEEcccEEEEEETTTTEEEEEEEcTTccHHHHTGGGccccEEEEEEEcGGGGcccccccccccTcT########### DISOP:02AL 1-3, 253-254| PSIPRED cccHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEcHHHHHHHHHcccEEEEEcHHHHcccccEEEEEEcccccccEEEEcccccHHHcccccEEEEEEcccccccccccEEEEcccccccccccccccccccEEEEEccEEEEEEccccEEEEEEEcccccHHHHHHHccccccccccccccccccHHHHHHHHHHccccccccHHcccc //