[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55354.1
DDBJ      :             putative CoA-transferase alpha subunit
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  156/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.124.1
:293 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->231 1k6dB PDBj 5e-14 32.4 %
:RPS:PDB   4->234 3cdkA PDBj 9e-32 25.2 %
:RPS:SCOP  4->291 1poiA  c.124.1.2 * 9e-44 26.9 %
:HMM:SCOP  3->274 1poiA_ c.124.1.2 * 1.7e-64 36.2 %
:RPS:PFM   5->233 PF01144 * CoA_trans 4e-17 36.8 %
:HMM:PFM   4->233 PF01144 * CoA_trans 9.1e-42 33.2 214/218  
:BLT:SWISS 1->288 Y3551_MYCTU e-130 76.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55354.1 GT:GENE BAD55354.1 GT:PRODUCT putative CoA-transferase alpha subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(524347..525228) GB:FROM 524347 GB:TO 525228 GB:DIRECTION - GB:PRODUCT putative CoA-transferase alpha subunit GB:PROTEIN_ID BAD55354.1 LENGTH 293 SQ:AASEQ MKDKRMSLDDVVGELRSGMTIGIGGWGSRRKPMALVRAILRSDLTDLTVVTYGGPDLGLLCSAGKVRKAYYGFVSLDSAPFYDPWFGKARTSGELVVREMDEGMLKCGLEAAAARLPFLPIRAGLGSDVFTFWEGELKTVTSPYPGPDGTPETLSAMPALTLDAALVHLNLGDKHGNAAYLGVDPYFDDLYCLAAERRYLSVERVVETEELVKTVPPQQLLLNRMMVDGVVEAPGGAHFTLAGEDYGRDEKFQRHYVEAAKSPESWQTFVDTYLAVSEDEYQAAVRRFADQEA GT:EXON 1|1-293:0| BL:SWS:NREP 1 BL:SWS:REP 1->288|Y3551_MYCTU|e-130|76.4|288/292| BL:PDB:NREP 1 BL:PDB:REP 1->231|1k6dB|5e-14|32.4|210/219| RP:PDB:NREP 1 RP:PDB:REP 4->234|3cdkA|9e-32|25.2|210/229| RP:PFM:NREP 1 RP:PFM:REP 5->233|PF01144|4e-17|36.8|209/213|CoA_trans| HM:PFM:NREP 1 HM:PFM:REP 4->233|PF01144|9.1e-42|33.2|214/218|CoA_trans| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01144|IPR004165| GO:PFM GO:0008410|"GO:CoA-transferase activity"|PF01144|IPR004165| RP:SCP:NREP 1 RP:SCP:REP 4->291|1poiA|9e-44|26.9|283/317|c.124.1.2| HM:SCP:REP 3->274|1poiA_|1.7e-64|36.2|265/0|c.124.1.2|1/1|NagB/RpiA/CoA transferase-like| OP:NHOMO 222 OP:NHOMOORG 174 OP:PATTERN ------1111111111-------1-------1------------------------------------ ----3---------11122-21--11222221211123551----1-1----2121-1--114--321-2-----------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------1-2-------1----------1-----1-1----21-11-11--11111-1---1--1--2---1111---1-----1-----1---1-----------------1--------------------------------13--1---1---1---1111----1111111-3212----------------1-------------------1---21----------------1-1------1--3------------------------------------1--------1------1-----------------1---1--1--111-1-1--11-111-1--11111112111---------------------1------1-------------------------------1---------------2112221-1-1-11111111----11111--------------------------11111------------------------------------------------------------------ -----------------------1-11-------------------------1-------------------------------------------------------------------------------------1-------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 281 STR:RPRED 95.9 SQ:SECSTR cccccccHHHHHTTccTTcEEEEcccTTcTccHHHHHHHHHHTcccEEEEEccccTTHHHHHTTcEEEEEEccccccEEccccHHHHHHHTTTccEEEEccHHHHHHHHHHHHHTccEEEEcTTTTcGGcTTTTTGTTccEEEETTccEEEEEEEEEEcccEEEEEEEEEEEETTccEEccGGGcTTHHHHHHHEEEEEEEEEEEEcTTccTTcccTTTccccGGGccEEEEccTTTTTcccccccccccccccHHHHHTTcHHHHHHHHHHHTcccHHHH############ DISOP:02AL 1-2, 289-293| PSIPRED cccccccHHHHHHHcccccEEEEccccccccHHHHHHHHHHcccccEEEEEcccccHHHHHHcccEEEEEEEcccccccccccHHHHHHHHcccEEEEEccHHHHHHHHHHHHcccccEEEcccccccccccccccEEEEEccccccccccEEEEEEEcccccEEEEEEEEEcccccEEEEEccccccHHHHHHccEEEEEEEEEcccHHHccccccccEEcccEEEEEEEEcccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHcc //