[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55359.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   50->148 3dteA PDBj 1e-05 25.0 %
:HMM:PFM   71->154 PF06114 * DUF955 6.5e-09 33.3 63/122  
:PROS 86->95|PS00142|ZINC_PROTEASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55359.1 GT:GENE BAD55359.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 529373..529888 GB:FROM 529373 GB:TO 529888 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55359.1 LENGTH 171 SQ:AASEQ MSQSRTQSSSRSYRRVAAAVDAVCAVAADFDATTLDEVVLAIAAERQRMIEIADAELGPGVCGQRRFYPDRDVIVLATALPSREHTLAHELGHIVFDHEGAPATEVTLEASDDLIAYMLSQRAHQQIVDDGADELAEWEAETFAAMLMTRLRVFNNRGAGVSVLRFDEALG GT:EXON 1|1-171:0| PROS 86->95|PS00142|ZINC_PROTEASE|PDOC00129| SEG 2->32|sqsrtqsssrsyrrvaaavdavcavaadfda| RP:PDB:NREP 1 RP:PDB:REP 50->148|3dteA|1e-05|25.0|80/241| HM:PFM:NREP 1 HM:PFM:REP 71->154|PF06114|6.5e-09|33.3|63/122|DUF955| OP:NHOMO 13 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --------------2------1---1------11111121----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 56.1 SQ:SECSTR #######################################HHHHHHTcTTccccEEEEcTTccE##EEETTTTEEEEETTccHHHHHHHHHHHHHH############HHHcHHHHHHH#####HHHccHHHHHHHHHHHHHHHHHHHHccHHHH################# DISOP:02AL 1-15| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEcccccHHHHHHHHHHEEEcccccccEEEEEEccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccc //