[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55360.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:340 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55360.1 GT:GENE BAD55360.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 529885..530907 GB:FROM 529885 GB:TO 530907 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55360.1 LENGTH 340 SQ:AASEQ MTLWLTALLVWVAAGARVGRVLVKPATTARVAIVVAVAAAAAAATLAVPEIALAVDNLLPEGAPPGMLADGVQVAAWLVFATATSVVAAAAWPVVSRRNLRQIALVIYGAGTLVIAATLVWSFTFGWCALALACVFIVVTGLRNLDWTALGRGIAIYTTGTALTGLLAVLEVRRAWVGEPAAPAGEPNWGWQAWEIAALLIALGAVWIVVELWMRARAVLRQTRALHRTMIKRFPEVIAHEQPSSSTQLRASDQVAQIMDALYLQSGGGVELAAAGAPPASIPERAERVARWARNPLGDIVIDARWIAPPEGVSPRGWVRAIARAFDTVDTPVLEHTASR GT:EXON 1|1-340:0| TM:NTM 5 TM:REGION 2->24| TM:REGION 31->53| TM:REGION 71->93| TM:REGION 111->133| TM:REGION 194->215| SEG 2->23|tlwltallvwvaagarvgrvlv| SEG 25->54|pattarvaivvavaaaaaaatlavpeiala| SEG 79->96|vfatatsvvaaaawpvvs| SEG 153->168|giaiyttgtaltglla| OP:NHOMO 5 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1121----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 241-252, 337-340| PSIPRED cHHHHHHHHHHHHccHHHcEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccEEEEEcHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHccccccEEEEEEEcccccccccHHHHHHHHHHHHHcccHHHHHcccc //