[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55361.1
DDBJ      :             putative DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1a.4.1
:138 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   6->104 2ao9A PDBj 3e-07 10.1 %
:RPS:SCOP  6->104 2ao9A1  a.4.1.17 * 2e-07 10.1 %
:HMM:SCOP  39->77 2a6cA1 a.35.1.13 * 0.00055 33.3 %
:HMM:PFM   33->74 PF01381 * HTH_3 4.7e-10 36.1 36/55  
:BLT:SWISS 1->69 Y1416_COXBU 7e-04 37.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55361.1 GT:GENE BAD55361.1 GT:PRODUCT putative DNA-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(531217..531633) GB:FROM 531217 GB:TO 531633 GB:DIRECTION - GB:PRODUCT putative DNA-binding protein GB:PROTEIN_ID BAD55361.1 LENGTH 138 SQ:AASEQ MADFAARLNKLFETVHPPGRKPHTNAEVAAALTASGHPISKPYLSQLRSGQRTNPSDETVAALAKFFKVKPDYFFNDIYAAKIDHDLELLSQLQGYGLRRLSSRAFDLSEESQNLLTSMAEKLRASEGLPEIPPDGTE GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 1->69|Y1416_COXBU|7e-04|37.9|58/100| RP:PDB:NREP 1 RP:PDB:REP 6->104|2ao9A|3e-07|10.1|99/117| HM:PFM:NREP 1 HM:PFM:REP 33->74|PF01381|4.7e-10|36.1|36/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 6->104|2ao9A1|2e-07|10.1|99/117|a.4.1.17| HM:SCP:REP 39->77|2a6cA1|0.00055|33.3|39/0|a.35.1.13|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 42 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- ----3---------61111-11111111111111111321----1---------------12---11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 75.4 SQ:SECSTR HHHHHHHHHHHHTTccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHcccccHHHHHHHHHHTTccccc################################## DISOP:02AL 127-138| PSIPRED cHHHHHHHHHHHEEEccccccccccHHHHHHHHHccccccHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccc //