[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55364.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->129 2z7aC PDBj 1e-23 44.7 %
:RPS:PDB   5->130 2a15A PDBj 1e-11 40.5 %
:RPS:SCOP  4->133 3dm8A1  d.17.4.20 * 6e-11 12.5 %
:HMM:SCOP  5->137 2a15A1 d.17.4.3 * 3.2e-21 27.7 %
:HMM:PFM   18->127 PF02136 * NTF2 7.2e-07 26.3 99/118  
:BLT:SWISS 18->124 SDIS_COMTE 8e-08 34.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55364.1 GT:GENE BAD55364.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(534673..535092) GB:FROM 534673 GB:TO 535092 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55364.1 LENGTH 139 SQ:AASEQ MTTVTDHPARTAGLASQAAVRARDKQAWLALFAPDAVVEDPIGPSGFDPEGKGHHGTEAIAAFWDKAIAPTESIEFLFGDSFACGNEVAFTGVIRSRLGGHVIDAEGVFTYRVDAAGKLAALRAYWEVDRAMRTTRPAQ GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 18->124|SDIS_COMTE|8e-08|34.3|99/125| BL:PDB:NREP 1 BL:PDB:REP 5->129|2z7aC|1e-23|44.7|123/133| RP:PDB:NREP 1 RP:PDB:REP 5->130|2a15A|1e-11|40.5|126/133| HM:PFM:NREP 1 HM:PFM:REP 18->127|PF02136|7.2e-07|26.3|99/118|NTF2| RP:SCP:NREP 1 RP:SCP:REP 4->133|3dm8A1|6e-11|12.5|128/135|d.17.4.20| HM:SCP:REP 5->137|2a15A1|3.2e-21|27.7|130/0|d.17.4.3|1/1|NTF2-like| OP:NHOMO 29 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- --------------12211-11--2111111211111111--------------------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 99.3 SQ:SECSTR cccccccHHHHHHHHHHHHHHTTcHHHHHHTEEEEEEEEccccccTTcTTcccEEcHHHHHHHHHHHTTTTcEEEEEEEEEcccTTEEEEEEEEEEEETTEEEEEEEEEEEEEcTTccEEEEEEEccGGGHHHHHHHH# DISOP:02AL 1-6, 135-139| PSIPRED cccccccHHHHHHHHHHHHHHcccHHHHHHHHccccEEEcccccccccccccccccHHHHHHHHHHHcccccEEEEEEcccEEcccEEEEEEEEEEEEccEEEEEEEEEEEEEccccHHHHHHHcccHHHHHHcccccc //