[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55365.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  163/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.1.16
:300 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   74->223 3c8nC PDBj 1e-09 33.6 %
:RPS:PDB   1->256 2b81B PDBj 5e-34 20.9 %
:RPS:SCOP  16->292 1brlB  c.1.16.1 * 1e-32 14.0 %
:HMM:SCOP  1->266 1rhcA_ c.1.16.3 * 3.7e-56 35.2 %
:RPS:PFM   12->231 PF00296 * Bac_luciferase 1e-20 36.3 %
:HMM:PFM   14->242 PF00296 * Bac_luciferase 4e-61 35.2 210/307  
:BLT:SWISS 5->291 Y965_MYCBO 9e-51 41.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55365.1 GT:GENE BAD55365.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(535089..535991) GB:FROM 535089 GB:TO 535991 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55365.1 LENGTH 300 SQ:AASEQ MTAPLQFTVGIALSPLDQLTALAVTAEECGFSSVALPDSLFYMQSQAAKYPYTADGSRFWGPDTPWVDPLIGATAMAAVTSRIRFYTNVLKLGSRNPLLLARQVGSVANLSNNRFGFGVGIGWAPEEFEWCGQPYARRGARVDEMIEVIKLVLGGGMVEFHGEFYDFEPLQMSPAPSAPVPFYIGGHTEAALRRAARVGDGWTSAMMTFDELTATIGKLDALRAEFGRSAEPFEIQAVCVDRGGRAGYQDLADAGVTDAIVVPWLLEGIGFDGELAAKQDALRRFAEKYIADPIVGRDAR GT:EXON 1|1-300:0| BL:SWS:NREP 1 BL:SWS:REP 5->291|Y965_MYCBO|9e-51|41.1|282/288| BL:PDB:NREP 1 BL:PDB:REP 74->223|3c8nC|1e-09|33.6|146/324| RP:PDB:NREP 1 RP:PDB:REP 1->256|2b81B|5e-34|20.9|239/309| RP:PFM:NREP 1 RP:PFM:REP 12->231|PF00296|1e-20|36.3|201/296|Bac_luciferase| HM:PFM:NREP 1 HM:PFM:REP 14->242|PF00296|4e-61|35.2|210/307|Bac_luciferase| RP:SCP:NREP 1 RP:SCP:REP 16->292|1brlB|1e-32|14.0|258/319|c.1.16.1| HM:SCP:REP 1->266|1rhcA_|3.7e-56|35.2|247/0|c.1.16.3|1/1|Bacterial luciferase-like| OP:NHOMO 542 OP:NHOMOORG 177 OP:PATTERN -----------------------22-11--11-------------------1--------------11 ----B---111---9IG88-8C11HH88888FCDFDBCEC2D3J44--1-----------556-4376233-----------2-------------------------1------------------------------11----5-----------------------2------------------------111111-1--11--1------1------1--------1----------------------------------------------------------------------------------------------------------------------------------------------------------1--1------2-------------22-2212212--2222---------------1-------------------1-----------------------------------4-------1111111----22--------1-2-----------1---1--1-------1-----------------------------------------------------------------------------1----------------------------------------1---1-1111111111-111111111111111111-121---------------------1--1111---1--------------------------------------------111-112-----1121-111111111323------------------------11----------------------------------------------------------------------- ----------------1------------------------------------------1--------------------------------1------------------------------------------------------------------------------------------------1----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 300 STR:RPRED 100.0 SQ:SECSTR HccTTccEEEEEccccTTHHHHHHHHHHHTccEEEEcccccccTTTcccGGGccHHHccGccTTTTTcccHHHHHHHTTccccEEEEEEEETTTccHHHHHHHHHHHHHHcTTcEEEEEEccccHHHHHHHTcccTTHHHHHHHHHHHHHHHHHcccccEEETTEEEccccccccccccccEEEEccTTccTHHHHcccEEcccTcccHHHHHHHHHHHHHHHHHHcTTccccEEEEEEEEcccTTcccEEETTEEHHHcccccHHHHHHEEEcHHHHHHHHHHHHHHHcccEEEcGGGc DISOP:02AL 299-300| PSIPRED cccccccccccccccHHHHHHHHHHHHHccccEEEEcHHHHcccccccccccccccccccccccccccHHHHHHHHHHHcccEEEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccEEccccEEccccccccEEEEEcccHHHHHHHHHHccEEEEccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEcccHHHHHHHHHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccHHHcccc //