[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55366.1
DDBJ      :             putative lipid-transfer protein
Swiss-Prot:             

Homologs  Archaea  64/68 : Bacteria  143/915 : Eukaryota  117/199 : Viruses  0/175   --->[See Alignment]
c.95.1
:390 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->123 2qo0B PDBj 2e-05 33.7 %
:RPS:PDB   19->382 2c7yA PDBj 2e-12 17.9 %
:RPS:SCOP  9->117 1eblA1  c.95.1.2 * 9e-10 29.1 %
:RPS:SCOP  205->374 1eblA2  c.95.1.2 * 7e-04 15.0 %
:HMM:SCOP  4->228 1ulqA1 c.95.1.1 * 3.9e-22 25.8 %
:HMM:SCOP  231->378 1ulqA2 c.95.1.1 * 6.5e-19 27.4 %
:RPS:PFM   32->83 PF00814 * Peptidase_M22 4e-07 55.1 %
:HMM:PFM   30->86 PF00814 * Peptidase_M22 3e-08 36.8 57/268  
:HMM:PFM   262->370 PF02803 * Thiolase_C 0.00024 24.7 89/123  
:BLT:SWISS 7->384 NLTP_HUMAN 2e-33 29.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55366.1 GT:GENE BAD55366.1 GT:PRODUCT putative lipid-transfer protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(535988..537160) GB:FROM 535988 GB:TO 537160 GB:DIRECTION - GB:PRODUCT putative lipid-transfer protein GB:PROTEIN_ID BAD55366.1 LENGTH 390 SQ:AASEQ MSFPAAVLGTGQTHHVTKRHDVSMAGMCREAIDRALADAGLTIADIDAVVVGKAPDMFEGVMMPELFLADALGASGKPLIRVHTAGSVGGSTGIVATNLVQAGVHKRVLAVAWEKQSESNAMWALSIPVPFTMPVGAGAGGYFAPHVRSYIRRSNAPSHIGAMVAVKDRRNGAKNPLAHLRQPDITLESVLASQMLWDPIRFDETCPSSDGACAIVLGDAEAAERVEAEGRKVAWVHGTAMRTEPTTYAGRDQVNPEAGRHAAAALWEAAGITDPLEEIDAAEIYVPFSWFEPMWLENLGFAAPGEGWKLTEKGETEIGGRLPVNPSGGVLSSNPIGASGLIRFAEAAKQVMERAGDYQVKGARKALGHAYGGGSQYFSMWVVGSERPRS GT:EXON 1|1-390:0| BL:SWS:NREP 1 BL:SWS:REP 7->384|NLTP_HUMAN|2e-33|29.8|372/547| SEG 220->229|aeaaerveae| BL:PDB:NREP 1 BL:PDB:REP 21->123|2qo0B|2e-05|33.7|101/331| RP:PDB:NREP 1 RP:PDB:REP 19->382|2c7yA|2e-12|17.9|330/391| RP:PFM:NREP 1 RP:PFM:REP 32->83|PF00814|4e-07|55.1|49/260|Peptidase_M22| HM:PFM:NREP 2 HM:PFM:REP 30->86|PF00814|3e-08|36.8|57/268|Peptidase_M22| HM:PFM:REP 262->370|PF02803|0.00024|24.7|89/123|Thiolase_C| GO:PFM:NREP 2 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF00814|IPR000905| GO:PFM GO:0006508|"GO:proteolysis"|PF00814|IPR000905| RP:SCP:NREP 2 RP:SCP:REP 9->117|1eblA1|9e-10|29.1|103/174|c.95.1.2| RP:SCP:REP 205->374|1eblA2|7e-04|15.0|133/143|c.95.1.2| HM:SCP:REP 4->228|1ulqA1|3.9e-22|25.8|225/0|c.95.1.1|1/1|Thiolase-like| HM:SCP:REP 231->378|1ulqA2|6.5e-19|27.4|124/0|c.95.1.1|2/2|Thiolase-like| OP:NHOMO 824 OP:NHOMOORG 324 OP:PATTERN 33111175889888551142321B41113-32111--1111111111111111111111112331-12 --1-5--1------7K844-4B--75444446E7D75D8B-D18--------111--1--226--215-71------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------1-----------6222-------24611152652--------------1--3-1115--111-----11113--1--1-----11--------1-------------------------------------31C3--C757-1112------1121------1-717B9-----11-221-3247--1----------------51--D26-----------1211112--------1----------------------------------1--2-------11------2---------------------------------------------------------------------------------------------------------------------1-------------------------1-1111111------1---------------------------------------------221122------------------------------------------------- ------1-211----122221112122111111111221212211111121111-11111111--------------------------12121-1----1-1111-2--111111-1211-1211-3-3A2-3121-11--2112-1-11-22-11123241221121121131--------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 366 STR:RPRED 93.8 SQ:SECSTR ###TEEEEEEEEcTTTcTTTTccTHHHHHHHHHHHHHTTTccGGGccEEEEEccccTTHHHHHHHHHHHHTTccTTccEEEccccccccHHHHHHHHHHHHTTcccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHccEEEEEEcTTTccEEEEEEcTTccHHHHHTccccccTTccccccccEEEEEEEEEEEHHHHHHHTcHHcccEEEEEEEEEEccGGGTTccGcHHHHHHHHHHHHHHHTTcc#cGGGccEEEEccccHHHHHHHHHHHTccGGGGG############GGGGccTTccHHHcccGGGHHHHHHHHHHHHHHHHcTTEEETTccEEEEEEEccTTEEEEEEE######## DISOP:02AL 388-390| PSIPRED ccccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHcccHHHHcEEEEEEccccccccccHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcHHcccccccccHHHHcccccccccccHHcccccccccEEEEEccHHHHHHcccccccEEEEEEEEEEcccHHcccccccccccHHHHHHHHHHHccccccHHHccEEEEEcccHHHHHHHHHHccccccccHHHHHHcccccccccEEEcccccHHHcccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccHHHHHEEEEEEEcccccc //