[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55372.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  97/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:139 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   4->132 3e5dA PDBj 2e-08 15.6 %
:RPS:SCOP  4->129 1sp9A  d.32.1.3 * 4e-09 7.3 %
:HMM:SCOP  1->134 1tsjA_ d.32.1.7 * 1.2e-20 31.5 %
:HMM:PFM   8->129 PF00903 * Glyoxalase 1.3e-06 22.6 115/128  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55372.1 GT:GENE BAD55372.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 543234..543653 GB:FROM 543234 GB:TO 543653 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55372.1 LENGTH 139 SQ:AASEQ MSSKMIFINLPVRELSRSKDFYQALGWKLNEDFTDDNAACIVVDDNICLMLLTRQYFQTFTKRPVAETTGATGAAYALSLGSAAEVDALTEAALAAGGSEEVNEDKRAQEAEVGMHGRTFLDPDGHQWEPFWMDYPGGA GT:EXON 1|1-139:0| SEG 66->85|aettgatgaayalslgsaae| RP:PDB:NREP 1 RP:PDB:REP 4->132|3e5dA|2e-08|15.6|122/122| HM:PFM:NREP 1 HM:PFM:REP 8->129|PF00903|1.3e-06|22.6|115/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 4->129|1sp9A|4e-09|7.3|123/362|d.32.1.3| HM:SCP:REP 1->134|1tsjA_|1.2e-20|31.5|127/0|d.32.1.7|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 108 OP:NHOMOORG 100 OP:PATTERN -------------------------------------------------------------------- --------111---1---------------------1221---1-----11-111-1---------11111-------------------------1----2----21-1----------------------------------1------------------------1----------------------------------------1--1-----------11111131--------------------1----------------------111----------------------------------------------------------------------------------------------1-----1-------2---------1----------1----------1---11---111-11--------1111----------------------------------------------------2--1111111111-----1111------1-1111------11----11-1---------------------1-1-------------------------1-11------------------------------------------------1111----1----------------------------------------------------------------------------1-----------------------------------------------------------------1-----------------------------------------11----------------------------------------------------------------------- ------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 100.0 SQ:SECSTR ccccccEEEEEcccHHHHHHHHHHHccEEcccEEEGGGTEEEEETcEEcccccEEEEEETTccccccccccccccEEEEcccHHHHHHHHHHHHHTTccEEEEEEcTTEEETTccEEEEEEcTTccEEEEEcEcTTcEE PSIPRED cccEEEEEEEccccHHHHHHHHHHHccEEccccccccEEEEEEcccEEEEEEcHHHHHHHccccccccccccEEEEEEEcccHHHHHHHHHHHHHcccEEcccccccccccccccEEEEEEcccccEEEEEEEcccccc //