[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55388.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:315 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   144->183 PF11239 * DUF3040 0.00065 40.0 40/82  
:BLT:SWISS 189->315 Y1363_MYCTU 7e-15 29.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55388.1 GT:GENE BAD55388.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 560077..561024 GB:FROM 560077 GB:TO 561024 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55388.1 LENGTH 315 SQ:AASEQ MSDSNDQSRRTRRKAVRSAGPPVGEPGEAPVTEAAAPGEGAGRAEVTGRAEASSKTDAAGSTKAAGSTEAAGSTQAAGSTEAVGQSEAAGEAEAAEAVSAKDGMQHTAKTSLAKSGLSKSGPSKAGLSKDGPDEKPADGAADDAAAAEQTDRRTGTGRRIFLAAAAVVLLAALITGAVFSVVTVRDIDQRAERRTEYVQTARQAILNLTTIRADSAKEDIDRILSLASGQFKTEFDGRVDPFLSIVQQAKVVSNGEIVEAALESDDDDSAKVLVAAKQTLTNAGQAEPQTRYYRFRVTVTRSDAGLTASNVEFVP GT:EXON 1|1-315:0| BL:SWS:NREP 1 BL:SWS:REP 189->315|Y1363_MYCTU|7e-15|29.9|127/100| TM:NTM 1 TM:REGION 161->183| SEG 19->45|agppvgepgeapvteaaapgegagrae| SEG 81->100|eavgqseaageaeaaeavsa| SEG 130->148|dgpdekpadgaaddaaaae| SEG 162->173|laaaavvllaal| SEG 264->269|sdddds| SEG 290->301|tryyrfrvtvtr| HM:PFM:NREP 1 HM:PFM:REP 144->183|PF11239|0.00065|40.0|40/82|DUF3040| OP:NHOMO 49 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ---------------4211-13--3222222243331-33----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-164, 282-288| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEccccccEEEEEEEEEEEEEcccccccccEEEEEEEEEEcccEEEEEcccccc //