[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55389.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:162 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   12->77 PF06864 * PAP_PilO 2e-04 39.7 %
:HMM:PFM   38->114 PF11393 * IcmL 1.6e-06 18.2 77/108  
:HMM:PFM   16->40 PF09976 * DUF2133 5.1e-06 32.0 25/43  
:BLT:SWISS 54->162 Y1362_MYCTU 3e-14 33.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55389.1 GT:GENE BAD55389.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 561021..561509 GB:FROM 561021 GB:TO 561509 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55389.1 LENGTH 162 SQ:AASEQ MKRTDRLIASFLAGAVALTALIVIGFGGWRHWSSEQDEKAREQALTAADRAVSAMFTYDHTTVDTELPKAADNLSPSFREDYLKLITAAIAPGAKEKQLTVKATTQAAGIVSADRDNAVVMLFLNQVTTSSDSPQGTTTGSRVRVNLNKDGDRWLVDAVTPI GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 54->162|Y1362_MYCTU|3e-14|33.9|109/220| TM:NTM 1 TM:REGION 6->27| RP:PFM:NREP 1 RP:PFM:REP 12->77|PF06864|2e-04|39.7|63/409|PAP_PilO| HM:PFM:NREP 2 HM:PFM:REP 38->114|PF11393|1.6e-06|18.2|77/108|IcmL| HM:PFM:REP 16->40|PF09976|5.1e-06|32.0|25/43|DUF2133| OP:NHOMO 81 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- --------------15322-24--6422222556661436----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 129-136| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHEEcccccEEEEEEEEEEEEccccccccEEEEEEEEEEEEEcccEEEEEcccc //