[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55393.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:56 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->39 PF11011 * DUF2849 0.00045 40.7 27/90  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55393.1 GT:GENE BAD55393.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(565482..565652) GB:FROM 565482 GB:TO 565652 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55393.1 LENGTH 56 SQ:AASEQ MAAKGSANDIADEDLEPLADETARQAQRVVAAYAADADECRMLLSMLGIGPNSRAE GT:EXON 1|1-56:0| SEG 23->38|arqaqrvvaayaadad| HM:PFM:NREP 1 HM:PFM:REP 13->39|PF11011|0.00045|40.7|27/90|DUF2849| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 52-56| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccc //