[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55395.1
DDBJ      :             putative MbtH family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  183/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.100.2
:80 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->65 2khrA PDBj 2e-31 81.5 %
:RPS:SCOP  9->65 2pstX1  d.100.2.1 * 3e-18 49.1 %
:RPS:PFM   3->54 PF03621 * MbtH 2e-18 73.1 %
:HMM:PFM   1->54 PF03621 * MbtH 1.2e-34 83.3 54/54  
:BLT:SWISS 1->65 MBTH_MYCTU 5e-31 81.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55395.1 GT:GENE BAD55395.1 GT:PRODUCT putative MbtH family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 566859..567101 GB:FROM 566859 GB:TO 567101 GB:DIRECTION + GB:PRODUCT putative MbtH family protein GB:PROTEIN_ID BAD55395.1 LENGTH 80 SQ:AASEQ MSTNPFDDEDGRFFVLVNDEEQHSLWPAFAEVPAGWRVVFGEDSRAACVEYVEKNWTDMRPKSLRDAMAADDAARQGAQS GT:EXON 1|1-80:0| BL:SWS:NREP 1 BL:SWS:REP 1->65|MBTH_MYCTU|5e-31|81.5|65/71| SEG 66->74|damaaddaa| BL:PDB:NREP 1 BL:PDB:REP 1->65|2khrA|2e-31|81.5|65/74| RP:PFM:NREP 1 RP:PFM:REP 3->54|PF03621|2e-18|73.1|52/53|MbtH| HM:PFM:NREP 1 HM:PFM:REP 1->54|PF03621|1.2e-34|83.3|54/54|MbtH| RP:SCP:NREP 1 RP:SCP:REP 9->65|2pstX1|3e-18|49.1|57/61|d.100.2.1| OP:NHOMO 241 OP:NHOMOORG 183 OP:PATTERN -------------------------------------------------------------------- ----2------1-134311-11--5311111311112111-212---------11-----33--7233261-------------------------------------------------------------------------2--1--11-----------------1-----------------------1111111111111111--11-1111----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------2----1----------------------------11----------1---------------------------------------------------------------------11111122222111122221-1111-1-----2--2--1---1--------1----------1-------------------------------11------------------------------------------------------------------------1-21-1-1-11111-11-1121111111111111111111-----11111111111111111111--11----------------------------11---------------------------211111112111111-211-----------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 81.2 SQ:SECSTR ccccccccccccEEEEEETTcccEEEETTccccccEEEEEccccHHHHHHHHHHHHHcccccccc############### DISOP:02AL 1-2, 67-80| PSIPRED ccccccccccccEEEEEcccccEEEcccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccc //