[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55396.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:98 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55396.1 GT:GENE BAD55396.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 567365..567661 GB:FROM 567365 GB:TO 567661 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55396.1 LENGTH 98 SQ:AASEQ MEVGPAMGRGIERGRGGRGRGRTRCSGCSSASSVLACWRWSVSAWPRNRRCTWRIAPRRPPRADRKSVHRKAVVANDGGAERCACLAGNGLRWCRGSG GT:EXON 1|1-98:0| SEG 8->24|grgiergrggrgrgrtr| SEG 57->62|prrppr| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-22, 61-67, 97-98| PSIPRED ccccccccccccccccccccccccccccccHHHHHHHHccccccccccccEEEEEcccccccccHHHHHHEEEEEccccccEEEEEcccccccccccc //