[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55398.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  347/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
d.13.1
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->130 1y23C PDBj 2e-15 37.6 %
:RPS:SCOP  4->130 1y23A  d.13.1.1 * 2e-23 34.6 %
:HMM:SCOP  1->130 1emsA1 d.13.1.1 * 2.1e-31 33.8 %
:RPS:PFM   13->98 PF01230 * HIT 1e-13 43.0 %
:HMM:PFM   12->101 PF01230 * HIT 9.6e-22 35.6 90/98  
:BLT:SWISS 1->133 YHI1_MYCLE 7e-46 62.4 %
:PROS 80->98|PS00892|HIT_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55398.1 GT:GENE BAD55398.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(568789..569214) GB:FROM 568789 GB:TO 569214 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55398.1 LENGTH 141 SQ:AASEQ MASVFSAIIAGQLPGRFVWEDDEFVGFLTIAPVTQGHTLVVPRAEIDQWQDVDPELFARLTGVAQKIGQAVRAAFDAPRAGLLIAGLEVPHLHLHVFPAYEMGNFDISGADPDPSPESLDEAQAKIKQALRDLGHSANVPD GT:EXON 1|1-141:0| BL:SWS:NREP 1 BL:SWS:REP 1->133|YHI1_MYCLE|7e-46|62.4|133/134| PROS 80->98|PS00892|HIT_1|PDOC00694| BL:PDB:NREP 1 BL:PDB:REP 4->130|1y23C|2e-15|37.6|125/138| RP:PFM:NREP 1 RP:PFM:REP 13->98|PF01230|1e-13|43.0|86/97|HIT| HM:PFM:NREP 1 HM:PFM:REP 12->101|PF01230|9.6e-22|35.6|90/98|HIT| RP:SCP:NREP 1 RP:SCP:REP 4->130|1y23A|2e-23|34.6|127/139|d.13.1.1| HM:SCP:REP 1->130|1emsA1|2.1e-31|33.8|130/160|d.13.1.1|1/1|HIT-like| OP:NHOMO 422 OP:NHOMOORG 389 OP:PATTERN --------1111111211------1---1-11---11111111-----11111----------1---- --1-11121111-122222-22112222222222223222-111-1------111111---111------------------------111111111--111111111-1-----------------------------11----11----------------------------------------1----11111111111111111211111111111111-111111--111111111111111111111--111-11-1--111111111111111111111111111111111111111111111111111111111-----------------------1--------------------------2-11111-1-11-11--1111111111111111111-11-1111-11-111111111111-1--1--11-----11----------------------------------------------111--122121111111----11--------11--11----1----11--------------------------111----1---111111----------------1---1-1111111-111111----1111-------------------------------------------1---1---------------------------------------1-11111111--111111------------------------------------------------------1111111111-11111----1----1--------------------------1------------------------111-1-----1111----------------------------------- ----------1----1----------1-----------------------1-----1-----------------------------1--3---11-------1--1---------1---------------------------------------------------------1-1----------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 90.8 SQ:SECSTR ##cHHHHHHHTcccccEEEEcccEEEEEcTTcccTTcEEEEEccccccGGGccHHHHHHHTTHHHHHHHHHHHHHcccEEEEEGGTcccccccEEEEEEccccTTcccccGGGccHHHHHHHHHHHHHHc########### DISOP:02AL 135-141| PSIPRED cccHHHHHHccccccEEEEEccEEEEEEcccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccEEEEEEEccEEccccccccccccccHHHHHHHHHHHHHHHHHHcccccccc //