[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55399.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  123/915 : Eukaryota  1/199 : Viruses  1/175   --->[See Alignment]
b.55.1
:125 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   9->122 3dcxA PDBj 2e-28 50.5 %
:RPS:PDB   10->123 3dcxC PDBj 3e-38 49.5 %
:RPS:SCOP  9->123 3dcxA1  b.55.1.13 * 7e-24 48.7 %
:RPS:PFM   5->123 PF08000 * DUF1696 8e-33 51.3 %
:HMM:PFM   1->123 PF08000 * DUF1696 3.4e-53 51.2 123/124  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55399.1 GT:GENE BAD55399.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(569254..569631) GB:FROM 569254 GB:TO 569631 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55399.1 LENGTH 125 SQ:AASEQ MGLIDGLMGNAGRVDPAQAQQEYAKLFGNGEQVYAAYILVRDAMLFTNRRLIIVDKQGLSGRKVNYHSIPYRAITHFAVETAGTFDLDAELLIWIAGTAEPVHKRFNRQVDIYEVQGILSHFVAV GT:EXON 1|1-125:0| BL:PDB:NREP 1 BL:PDB:REP 9->122|3dcxA|2e-28|50.5|111/114| RP:PDB:NREP 1 RP:PDB:REP 10->123|3dcxC|3e-38|49.5|111/112| RP:PFM:NREP 1 RP:PFM:REP 5->123|PF08000|8e-33|51.3|119/123|DUF1696| HM:PFM:NREP 1 HM:PFM:REP 1->123|PF08000|3.4e-53|51.2|123/124|DUF1696| RP:SCP:NREP 1 RP:SCP:REP 9->123|3dcxA1|7e-24|48.7|115/116|b.55.1.13| OP:NHOMO 127 OP:NHOMOORG 126 OP:PATTERN --------------------------------1----------------------------------- ------1---11------------------------1--1-------11-1---1---------111-11-----------1-------------------111-1--------------------------------------1----------11------------------------------------2111111-11111111----11111---111111111-1---------------------1------------------------11111---1--------------------------1111111111-----11111111111-11-----1-1------11----------------------------------------------------111111111-------------------------------------------------------------------------------1---------------------------------------------1------------------------------1-----1------------1------1-------------------------------1----11-11111--1111-1111-11----------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1-----11---------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----- ----------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- STR:NPRED 124 STR:RPRED 99.2 SQ:SECSTR #cTTHHccEccEEccHHHHHHHHGcGGcTTccEEEEEEETTEEEEEEccEEEEEEEcTTTcccEEEEEEEGGGEEEEEEEEcccccccEEEEEEETTccccEEEEEcTTccHHHHHHHHHHHHHH PSIPRED cccHHHHccccccccHHHHHHHHHHHHccccEEEEEEEEEEEEEEEEccEEEEEEcccccEEEEEEEEcccccEEEEEEEEccccccccEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHcc //