[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55403.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->60 3iuvA PDBj 8e-07 54.5 %
:RPS:PDB   28->76 2dt5A PDBj 8e-04 10.2 %
:RPS:SCOP  28->78 1pb6A1  a.4.1.9 * 5e-05 23.5 %
:HMM:SCOP  6->82 2gfnA1 a.4.1.9 * 3.9e-13 26.0 %
:HMM:SCOP  86->200 2gfnA2 a.121.1.1 * 9.5e-06 28.6 %
:HMM:PFM   16->60 PF00440 * TetR_N 1.5e-09 31.1 45/47  
:HMM:PFM   114->163 PF06969 * HemN_C 0.00069 32.7 49/118  
:BLT:SWISS 28->95 YBJK_ECOLI 9e-06 34.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55403.1 GT:GENE BAD55403.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 573449..574105 GB:FROM 573449 GB:TO 574105 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55403.1 LENGTH 218 SQ:AASEQ MITATTPKGERRRQALVAAAAELLLEGGFDAVRHRSVATRADLPLASTTYYFESLEDLIARAVEFSGNAELEAMRRRIGEVSHRRRGAEATVELVLDLLIGGDWQDEAARGQLIARYERSVASARHPELREVQLRLRAQLEELLADVLRRSDRGVRAEHLRRLVAVVDGAVVAALTENDPDPRRMARAALLEVIDIVAPPLRSPGPEHVNGHGVRQLD GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 28->95|YBJK_ECOLI|9e-06|34.8|66/100| SEG 10->26|errrqalvaaaaellle| SEG 128->145|elrevqlrlraqleella| SEG 164->174|vavvdgavvaa| BL:PDB:NREP 1 BL:PDB:REP 28->60|3iuvA|8e-07|54.5|33/172| RP:PDB:NREP 1 RP:PDB:REP 28->76|2dt5A|8e-04|10.2|49/210| HM:PFM:NREP 2 HM:PFM:REP 16->60|PF00440|1.5e-09|31.1|45/47|TetR_N| HM:PFM:REP 114->163|PF06969|0.00069|32.7|49/118|HemN_C| RP:SCP:NREP 1 RP:SCP:REP 28->78|1pb6A1|5e-05|23.5|51/72|a.4.1.9| HM:SCP:REP 6->82|2gfnA1|3.9e-13|26.0|77/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 86->200|2gfnA2|9.5e-06|28.6|112/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- --------------11111-11--1111111111111111------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 49 STR:RPRED 22.5 SQ:SECSTR ###########################TccEEcHHHHHHHHTccHHHHHHHHHHTTccccTTTcEEHHHHHHHHHH############################################################################################################################################## DISOP:02AL 1-15| PSIPRED cccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccccccc //