[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55405.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  49/68 : Bacteria  744/915 : Eukaryota  149/199 : Viruses  0/175   --->[See Alignment]
d.13.1
:200 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   60->168 3imiC PDBj 3e-21 49.1 %
:RPS:SCOP  59->192 1y23A  d.13.1.1 * 8e-29 38.9 %
:HMM:SCOP  44->192 1emsA1 d.13.1.1 * 3.7e-35 41.2 %
:RPS:PFM   70->164 PF01230 * HIT 2e-19 48.9 %
:HMM:PFM   68->162 PF01230 * HIT 2.2e-27 43.6 94/98  
:BLT:SWISS 60->170 YHIT_BORBU 2e-23 46.8 %
:PROS 142->160|PS00892|HIT_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55405.1 GT:GENE BAD55405.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 575538..576140 GB:FROM 575538 GB:TO 576140 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55405.1 LENGTH 200 SQ:AASEQ MLIGPERAPCVVTLRCRLRALTARAVSPLPRPGLRIRLRRTLPRLARRLRLRFGVDPYTIFSDIIAGRAPASTVYEDSDVLAFMDIRPMTPGHLLVVPKVPARSLAELDPAIGGKLFQVGQKLAAALRASEVACDGVNFFLADGVAAGQEVFHVHLHVIPRTAGDGFGLRGRPTSPPRADLDYLAGSIRGALTRAGSASS GT:EXON 1|1-200:0| BL:SWS:NREP 1 BL:SWS:REP 60->170|YHIT_BORBU|2e-23|46.8|111/139| PROS 142->160|PS00892|HIT_1|PDOC00694| SEG 10->26|cvvtlrcrlraltarav| SEG 28->52|plprpglrirlrrtlprlarrlrlr| BL:PDB:NREP 1 BL:PDB:REP 60->168|3imiC|3e-21|49.1|108/140| RP:PFM:NREP 1 RP:PFM:REP 70->164|PF01230|2e-19|48.9|94/97|HIT| HM:PFM:NREP 1 HM:PFM:REP 68->162|PF01230|2.2e-27|43.6|94/98|HIT| RP:SCP:NREP 1 RP:SCP:REP 59->192|1y23A|8e-29|38.9|131/139|d.13.1.1| HM:SCP:REP 44->192|1emsA1|3.7e-35|41.2|148/160|d.13.1.1|1/1|HIT-like| OP:NHOMO 1192 OP:NHOMOORG 942 OP:PATTERN 11-1--1-111111121111111-11111111---11111111------1111-111-1--121-221 1-1-2-11---1-132222-22112222222222223322--111--1-121111111--2111-22--1-1---111-11--11-1-11---1111---11-11-11-1----------11111-11111-111111111--11321--1111122111-1-111-1111-1111111111111-11--1111111111111111111112211111111111111111122111111111111111111111121211111122111111211111111111111111111111111111111111111111111111111-1-111111111111111111111111121111111-1-1111---11-1311211111111111112111111211111111111-111111111111111111111111111111---1---1111111111-1111-1-111------------------------------1-12212222222222222222222212222222211-1-111222212111112111111111111111212--1111---1111111211111121111-3-111111111111---------1111111111111-111-1111111111111111111--1-111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11-----1111-2111111111111111111111111111111333312112111111111111111111111111111121121111-11111----1111--111111111111--111111-11-1111---1-111111111-1--------1 -----11-211111-2211--------11-1---2221111111-1----1111111-11-211111---11-1--1---1---1-11-323232211-1222-111231421222-1-2311-34121673-33621-131342222212--31221221213121234122422121L11-1122361233231121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 55.0 SQ:SECSTR ##########################################################cHHHHHHTTcccccEEEEcccEEEEEcTTcccTTcEEEEEccccccGGGccHHHHHHHHHTHHHHHHHHHHHHHcccEEEEEccccGGGTcccccccEEEEEEccTcccc################################ DISOP:02AL 1-3, 196-200| PSIPRED ccccccccccEEcHHHHHHHcccEEEcccccccHHHHHHHccHHHHHHHHHcccccccccHHHHHccccccEEEEEccEEEEEEcccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccEEEEEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHccc //