[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55407.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:348 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   27->228 PF10092 * DUF2330 2e-20 36.2 %
:HMM:PFM   27->240 PF10092 * DUF2330 4.9e-67 32.7 214/348  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55407.1 GT:GENE BAD55407.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(577222..578268) GB:FROM 577222 GB:TO 578268 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55407.1 LENGTH 348 SQ:AASEQ MRTATAARLAAAAAVLCTALGMGAVAPASACACGGVVSPGDTARVDQETAVLAWDGRRETILMRLALTAESAHAALIVPTPRPATVTAGSPDTFAELSRLTAPEFVVETEWFADAADGSGAPAAVAPTVLDQVRLGPLEATTLSGGDLTGLRTWLGANGYALRPEVTATLAPYVREGWSFVAMRLTGAQPLDGALDPVRLSFDSDRLVYPMRMSAAARTPQSVHLYVLDRHRVARADDDAAHHYSSVEFAGRVDPADVADPLLRELTAAGQDYLTEMQVHIADPTTVTTDFTFTAAPEDADYRRRFVQTDEVMLFGLPAGYVVLGAAGLAAAVVVIAVVRVARARPGA GT:EXON 1|1-348:0| TM:NTM 2 TM:REGION 12->34| TM:REGION 315->337| SEG 3->20|tataarlaaaaavlctal| SEG 113->127|adaadgsgapaavap| SEG 229->243|drhrvaradddaahh| SEG 283->297|dpttvttdftftaap| SEG 316->347|glpagyvvlgaaglaaavvviavvrvararpg| RP:PFM:NREP 1 RP:PFM:REP 27->228|PF10092|2e-20|36.2|199/322|DUF2330| HM:PFM:NREP 1 HM:PFM:REP 27->240|PF10092|4.9e-67|32.7|214/348|DUF2330| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----1------------11-1---1-1111111---1--------1---------------------1----------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 346-348| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHEEEEEEEEEEEcccEEEEEEEEccccccccEEEEccccccccEEEccHHHHHHHHHccccEEEEEcccccccccccccccccccEEEEEEEEccEEEEEEEccccHHHHHHHHcccccccHHHHHHHHHHHHcccEEEEEEEEHHHHHHccccEEEEEEccccccccEEEHHHcccccEEEEEEEEccccccccHHHcccccEEEEEEEccccccccHHHHHHHccccEEEEEEEEEEccccEEcccEEEcccccccHHHHHEEEEccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHccccc //