[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55409.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:254 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   77->230 2c1gA PDBj 3e-09 12.5 %
:HMM:SCOP  35->159 2cc0A1 c.6.2.3 * 0.00015 24.5 %
:HMM:PFM   55->150 PF10096 * DUF2334 3.3e-06 24.0 96/243  
:HMM:PFM   226->251 PF07618 * DUF1580 0.0003 38.5 26/56  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55409.1 GT:GENE BAD55409.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 580510..581274 GB:FROM 580510 GB:TO 581274 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55409.1 LENGTH 254 SQ:AASEQ MFVAPSSALHGAYMSIRHRWCMNAELIVSVSGIRDTTRDAAIEFAAEMDRREVRLSLLVAPRLEGKYRLTDDPATQAWLRGRRARGDAIVLHGYDQAATKRRRAEFATLPRHEARLRLTAADRVMEQVELRTRLFAAPRWNASTGALAALPEVGFRLALGLTGIHDLERDTVQRARVYGIGEGFRAEPWWCRALVMGAARTARRGGVLRLAISGAQLRRPGPRQAMLDAVDLALYHGAVSEVYRWQPGPVAQAA GT:EXON 1|1-254:0| RP:PDB:NREP 1 RP:PDB:REP 77->230|2c1gA|3e-09|12.5|136/384| HM:PFM:NREP 2 HM:PFM:REP 55->150|PF10096|3.3e-06|24.0|96/243|DUF2334| HM:PFM:REP 226->251|PF07618|0.0003|38.5|26/56|DUF1580| HM:SCP:REP 35->159|2cc0A1|0.00015|24.5|110/0|c.6.2.3|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 32 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- ----11-11111--11111-11--1111111111111111------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 136 STR:RPRED 53.5 SQ:SECSTR ############################################################################HHHHHHHHTTcEEEEcccccc#######cGGGccHHHHHHHHHHHHHHHHHHcccccEEccGGGcccHHHHHHcccEEEcccEEccHHHHccHHHHHHHHHHHccTTEEEEEE######TTcHHHHH###HHHHHH##HHHHHTTcEEccHHHH######################## DISOP:02AL 1-5, 251-254| PSIPRED ccccccHHHHHHHHHHHHHHEEccEEEEEEEcccccHHHHHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHHHHcccEEEEEccccccccccccHHHcccHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHcccccEEEEcccccEEcccccEEEcccccccccccccHHHHHHHHHHHHHHHHHccEEEEEEEHHHHcccHHHHHHHHHHHHHHHccccEEEEEEccccccccc //