[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55411.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  49/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:216 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->59 2i7vA PDBj 7e-05 46.7 %
:RPS:PDB   6->181 2bgaA PDBj 8e-10 16.9 %
:RPS:SCOP  2->195 1vjnA  d.157.1.4 * 4e-12 16.6 %
:HMM:SCOP  6->182 1ycgA2 d.157.1.3 * 9.5e-20 28.1 %
:HMM:PFM   6->177 PF00753 * Lactamase_B 1.8e-10 25.0 168/194  
:BLT:SWISS 1->179 Y020_PYRFU 2e-09 32.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55411.1 GT:GENE BAD55411.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(583272..583922) GB:FROM 583272 GB:TO 583922 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55411.1 LENGTH 216 SQ:AASEQ MRIAHFGHSCILVELHGKKILFDPGTFSHGFEGITGLDAIAVTHQHPDHIDPERIDALVEANPGARLLSDPQTAAQRGGRWEAVHAGAVLDLDALRITGGGGRHAVIHPEIPVIDNTVFQLGTADDPAQLVHPGDSLWVPPVPVGVLATPAAAPWMKISEAVDYLRAVNPRTAIPIHFGVVAPEARGIYFGRLTEMGPDGTEFTVLNPEDSRDFSA GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 1->179|Y020_PYRFU|2e-09|32.7|162/210| BL:PDB:NREP 1 BL:PDB:REP 7->59|2i7vA|7e-05|46.7|45/433| RP:PDB:NREP 1 RP:PDB:REP 6->181|2bgaA|8e-10|16.9|166/216| HM:PFM:NREP 1 HM:PFM:REP 6->177|PF00753|1.8e-10|25.0|168/194|Lactamase_B| RP:SCP:NREP 1 RP:SCP:REP 2->195|1vjnA|4e-12|16.6|163/194|d.157.1.4| HM:SCP:REP 6->182|1ycgA2|9.5e-20|28.1|160/0|d.157.1.3|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 53 OP:NHOMOORG 50 OP:PATTERN --------------------1----------------------------------------------- ----11-1111---11111-11--1111111-11111111----111--11-111111--1111111231----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 212 STR:RPRED 98.1 SQ:SECSTR ccEEEEEEEEEEEEETTEEEEEcccccHHHHHHTccEEEEEcccccHHHHTTHTGTHHHHHHTTcEEEccHHHHHHHHHTTccccccccccEEEEEEETTEEEEEEcccccccccccEEEEETTETTTTEEEEETcccTTcccccccccccHHHHHHHHHHHHHHHcTTccEEEEcccccEHTTcccTHccTTTcccGGGccHHHHcccHHH#### DISOP:02AL 216-217| PSIPRED cEEEEEEccEEEEEEccEEEEEccccccccccccccccEEEEEccccccccHHHHHHHHHcccccEEEEcHHHHHHccccEEEEccccEEEEccEEEEEEEEEEccEEccccccccEEEEEEEEccccEEEEcccccccccccccEEEEEcccccccHHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHcccccEEEEcccccEEEEcc //