[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55412.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  162/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.284.1
:78 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->73 1twjC PDBj 4e-11 42.5 %
:RPS:PDB   1->74 3d54B PDBj 6e-24 25.7 %
:RPS:SCOP  1->74 1vq3A  d.284.1.1 * 2e-22 25.7 %
:HMM:SCOP  1->78 1t4aA_ d.284.1.1 * 2.3e-20 44.9 %
:RPS:PFM   3->74 PF02700 * PurS 1e-11 51.4 %
:HMM:PFM   4->74 PF02700 * PurS 1.2e-26 45.1 71/80  
:BLT:SWISS 1->78 Y221A_MYCLE 2e-28 74.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55412.1 GT:GENE BAD55412.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 584079..584315 GB:FROM 584079 GB:TO 584315 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55412.1 LENGTH 78 SQ:AASEQ MARVVVEVMPKAEILDPQGQAIVGALPRLGFAGISDVRQGKRFELDVDDSVSDAELEQIAESLLANTVIEEWKVVRLS GT:EXON 1|1-78:0| BL:SWS:NREP 1 BL:SWS:REP 1->78|Y221A_MYCLE|2e-28|74.4|78/79| BL:PDB:NREP 1 BL:PDB:REP 1->73|1twjC|4e-11|42.5|73/79| RP:PDB:NREP 1 RP:PDB:REP 1->74|3d54B|6e-24|25.7|74/82| RP:PFM:NREP 1 RP:PFM:REP 3->74|PF02700|1e-11|51.4|72/79|PurS| HM:PFM:NREP 1 HM:PFM:REP 4->74|PF02700|1.2e-26|45.1|71/80|PurS| GO:PFM:NREP 1 GO:PFM GO:0016879|"GO:ligase activity, forming carbon-nitrogen bonds"|PF02700|IPR003850| RP:SCP:NREP 1 RP:SCP:REP 1->74|1vq3A|2e-22|25.7|74/86|d.284.1.1| HM:SCP:REP 1->78|1t4aA_|2.3e-20|44.9|78/80|d.284.1.1|1/1|PurS-like| OP:NHOMO 163 OP:NHOMOORG 162 OP:PATTERN -------------------------------------------------------------------- 1-1-11-111111111111-11111111111111111111111111111111111111--11111111111----------------------------------1------------------------------------------1--------1----------------------------------11111111111111111--11--1111-11-11------11--------------------1----------------1-------------------------------------------------------------------------------------------------------------111111------------11111111111-1111111--111-2--1---11111111-11111--111------------1111------------------------------111-1-----------------------------------------------------------------------------------------------1-11-----1111---------------1--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 94.9 SQ:SECSTR EEEEEEEEEEcTTcccHHHHHHHHHHHHTcccccccccccEEEEEEEEccHHHHHHHHHHHHTTccTTTEEEEE#### DISOP:02AL 78-79| PSIPRED cEEEEEEEEEccccccHHHHHHHHHHHHcccccccEEEEEEEEEEEEccccHHHHHHHHHHHHcccccEEEEEEEEEc //