[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55421.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  68/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.106.1
:128 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   52->115 3cnuA PDBj 1e-07 17.2 %
:RPS:SCOP  72->115 1c44A  d.106.1.1 * 4e-04 15.9 %
:HMM:PFM   46->110 PF07398 * MDMPI_C 0.00059 21.2 52/82  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55421.1 GT:GENE BAD55421.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 595007..595393 GB:FROM 595007 GB:TO 595393 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55421.1 LENGTH 128 SQ:AASEQ MGRRSVDAGELRAAVGAVRGWLIDAGAGEPGRKEMGAAVRATARALAGSVPGHSVEVRVPPFVAVQCVEGPRHTRGTPPNVVETDPRTWLLLATGLRDFDEAVAAGEVTASGSRAGEIARWLPVVRVE GT:EXON 1|1-128:0| SEG 37->47|aavratarala| RP:PDB:NREP 1 RP:PDB:REP 52->115|3cnuA|1e-07|17.2|64/110| HM:PFM:NREP 1 HM:PFM:REP 46->110|PF07398|0.00059|21.2|52/82|MDMPI_C| RP:SCP:NREP 1 RP:SCP:REP 72->115|1c44A|4e-04|15.9|44/123|d.106.1.1| OP:NHOMO 68 OP:NHOMOORG 68 OP:PATTERN -------------------------------------------------------------------- ----111111111-11111-11111111111111111111111111111111111111--1-1111111111111-11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 64 STR:RPRED 50.0 SQ:SECSTR ###################################################cEEEEEEETTEcTTccEEEEEcccccccEEEEccHHHHHHHHTTcccHHHHHHHTccEEEccHH############# DISOP:02AL 1-6| PSIPRED cccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccEEEEEEccccccccccccccEEccHHHHHHHHcccccHHHHHHcccEEEEcccHHHHHHHcccEEEc //