[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55422.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:186 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55422.1 GT:GENE BAD55422.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 595398..595958 GB:FROM 595398 GB:TO 595958 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55422.1 LENGTH 186 SQ:AASEQ MNAPRRSASSEASVPCETVPGTSPPRGEPIVWPSDWPREPREIATAVDAAVAAARAGDAAAFREATGELAELPGEQVGLVLAAIVRELLETAHPDGLTGDDARAVLEQVVRGAAAWLPEVDTGAVVAALTGALGVADPEDTTAPAAVPPAAVLLTAHLADLARVPVRDYIRRALGEIARAETVEMP GT:EXON 1|1-186:0| SEG 44->67|atavdaavaaaragdaaafreatg| SEG 120->159|vdtgavvaaltgalgvadpedttapaavppaavlltahla| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-15, 185-186| PSIPRED cccccccccccccccccccccccccccccEEccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccc //