[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55423.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.13.1
:452 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   65->206 3c3lB PDBj 2e-04 8.8 %
:RPS:SCOP  343->398 1gu8A  f.13.1.1 * 1e-04 28.6 %
:RPS:PFM   49->404 PF12051 * DUF3533 1e-29 30.8 %
:HMM:PFM   37->417 PF12051 * DUF3533 6e-33 19.7 356/382  
:BLT:SWISS 56->186 PIP_LACLA 1e-06 26.9 %
:BLT:SWISS 288->409 YHGE_BACSU 1e-04 27.2 %
:PROS 40->57|PS01307|MOTA
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55423.1 GT:GENE BAD55423.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(595963..597321) GB:FROM 595963 GB:TO 597321 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55423.1 LENGTH 452 SQ:AASEQ MTSAKDTTSEKDTPTARGPLQPPVTHPVLRIVVFPVVVLALLTTLLGYMYLAYVADPQENLHDFPIALVNLDVGETLGTPEQPRQVNFGTQVADGIREAVPKDQIDLRVLGINEAQQQMRTGQVYGAIIIPGDFSKRLGILGVGSVIPGEIEQPILTVQTNPRVGPYATAIVTRMADQMFPQVNEQVGKQLTEQVQAQLTPPEGGQPTELSGATRLSLDSPLRLVVEEFRPLPSGTGQGLTAFFYALLLLLVGVVGAMTIHTMVDAALGFVPTEYGPWYVHYPPTPISRFRTLLIKWGVFALMAAIVAGIFLLVAKALDMPLEHPLALYLYSAFAMIAVGVTGLSTLAAIGSAGLLVNLILFVVLGLPSSGGTVPIEATPHYFGWLATFEPMHQVFLAVRAILYFNADFSAGLTRGLLMTILGLVIGLVFGVVITRYYDYKGLHRGANNGAA GT:EXON 1|1-452:0| BL:SWS:NREP 2 BL:SWS:REP 56->186|PIP_LACLA|1e-06|26.9|119/901| BL:SWS:REP 288->409|YHGE_BACSU|1e-04|27.2|114/775| PROS 40->57|PS01307|MOTA|PDOC01011| TM:NTM 6 TM:REGION 30->52| TM:REGION 245->267| TM:REGION 293->315| TM:REGION 337->359| TM:REGION 389->411| TM:REGION 415->437| SEG 28->46|vlrivvfpvvvlallttll| SEG 247->256|lllllvgvvg| SEG 421->434|ilglviglvfgvvi| RP:PDB:NREP 1 RP:PDB:REP 65->206|3c3lB|2e-04|8.8|136/1085| RP:PFM:NREP 1 RP:PFM:REP 49->404|PF12051|1e-29|30.8|321/350|DUF3533| HM:PFM:NREP 1 HM:PFM:REP 37->417|PF12051|6e-33|19.7|356/382|DUF3533| RP:SCP:NREP 1 RP:SCP:REP 343->398|1gu8A|1e-04|28.6|56/218|f.13.1.1| OP:NHOMO 27 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ----1----------1111-1-111-111111----1123---1-----------1-----------1----------1---------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 136 STR:RPRED 30.1 SQ:SECSTR ################################################################EEcTTccEEEcccccTTTcHHHHTTEEcccEEEccccTTcHHHHHHHHHHHHHTTccGG####GccHHHHHHHHH##HHHTTTTHHHHHHHHHHHHHccccTTHHHHHHHHHGGGccHHHHHHHHHHHHHHHcccGGGEEEc###################################################################################################################################################################################################################################################### DISOP:02AL 1-17, 147-149, 173-174, 176-178, 203-207, 445-452| PSIPRED cccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccEEEEEccccccccccccccHHHHHHHHHHHHHcccccccccEEEEcHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHcccHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHEEEEccccccccccccc //