[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55427.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  286/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
b.58.1
:229 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   56->165 1o65B PDBj 1e-08 29.1 %
:HMM:SCOP  6->207 1o65A_ b.58.1.2 * 8.5e-55 38.7 %
:HMM:PFM   44->165 PF03473 * MOSC 7.2e-29 32.0 122/133  
:BLT:SWISS 27->176 YFLK_BACSU 3e-18 33.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55427.1 GT:GENE BAD55427.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(602251..602940) GB:FROM 602251 GB:TO 602940 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55427.1 LENGTH 229 SQ:AASEQ MTSEDARVLAVCVVHAELTVPTRVGRTAIDKRPVPGRVAVGTLGLAGDHVCDTKHHGGVDQAVYAYAEEDARRWSEELGRDLPAGWFGENLRIAGLDVSDAVVGARWSIGDTLLEVSAPRVPCATFGHWSGEAQWVKRFTLRSDTGTYLRVLRAGSIGAGDPVRVEYTPAHGITVRDVFTGADLDRLVTLLTVEPTVTDTVRMQIERHARRHGRPLPEIGDDLAEEAVS GT:EXON 1|1-229:0| BL:SWS:NREP 1 BL:SWS:REP 27->176|YFLK_BACSU|3e-18|33.3|150/221| SEG 187->201|lvtlltveptvtdtv| BL:PDB:NREP 1 BL:PDB:REP 56->165|1o65B|1e-08|29.1|110/217| HM:PFM:NREP 1 HM:PFM:REP 44->165|PF03473|7.2e-29|32.0|122/133|MOSC| HM:SCP:REP 6->207|1o65A_|8.5e-55|38.7|199/233|b.58.1.2|1/1|PK beta-barrel domain-like| OP:NHOMO 352 OP:NHOMOORG 305 OP:PATTERN -------------------------------------------------------------------- -21-31-1111--11--11-11--111111111111112212--1-11----1111----111-2-1111------------1---------------------1-------------------------------111-----1----1----------------1--2-------------112-------1222222221222222112211222-111---1111112111111111111111111111------------------------------------------------------------------------------------------------------------------------1-1----------21---11-----11111111111-11-1111-----111111-221---1-----21-11--1------------1-1-------------------------------1---------111111-1111---21111111--2222-111111-11-1-----------11------------1------------------1-------1-1---11-1-1111-1---------1------11-1--1-1--11111111----1111-11-----1-------11--11----1-111--------11----1------------11111-11111111111111---------1------------------------1-------111-1-11-11---------11--212211-------2------------12--1------1111--11111111--------------------------------------------------------------- ---------------1-1-----111----------------------112222-1111111-------------------------------------------------------------------------------------------------------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 48.0 SQ:SECSTR #######################################################cccGGGcEEEEETHHHHHHHHHcGGGGGTTTTcccEEEccccTTTccTTcEEEETTEEEEEEEEccccTHHHHHTTcTTHHHHHHHHTcccEEEEEEEcEEEETTccEEE################################################################ DISOP:02AL 1-4, 212-229| PSIPRED ccccccEEEEEEEEEcEEccccccEEcccccEEccHHEEEEccccccccccccccccccccEEEEEcHHHHHHHHHHHccccccccccccEEEEcccHHccccccEEEEccEEEEEcccccHHHHHHHHHcccccHHHHHHccccEEEEEEEcccEEccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccHHHHcccc //