[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55429.1
DDBJ      :             putative aminotransferase
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  258/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
e.17.1
:305 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->276 1daaA PDBj 7e-14 26.3 %
:RPS:PDB   9->299 1a0gB PDBj 8e-43 21.3 %
:RPS:SCOP  6->293 1et0A  e.17.1.1 * 3e-40 17.3 %
:HMM:SCOP  5->297 1daaA_ e.17.1.1 * 8.4e-59 30.4 %
:RPS:PFM   48->276 PF01063 * Aminotran_4 5e-20 36.2 %
:HMM:PFM   48->281 PF01063 * Aminotran_4 5.6e-40 33.2 214/232  
:BLT:SWISS 7->276 ILVE_METJA 2e-20 28.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55429.1 GT:GENE BAD55429.1 GT:PRODUCT putative aminotransferase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 604285..605202 GB:FROM 604285 GB:TO 605202 GB:DIRECTION + GB:PRODUCT putative aminotransferase GB:PROTEIN_ID BAD55429.1 LENGTH 305 SQ:AASEQ MVDRVLVTLDGVVRDADEPLLFADDIGVLRGDGVFETVLVRDGDACAIEFHLGRLRRSAQALDLPEPELSRWREAVQTAAKEWGSEREGMMRLVLTRGRDTELGAPSSVTSGDLAAAVPVPTAYVLVVPVPERVAKARAEGVSVVTLARGISIDLAQAAPWQLLGAKTLSYATNMAALRFAHRMGADDVIFTSTENRVLEGPRSTVVIARDKELITPPAKNGVLPGVTQRALFTEAKKAGWECRYAPLFTADLLTCDSIWMLSSVTLAARVNSLDGLRMSAPDNAEEIIELVDRGVQRGGAIGDW GT:EXON 1|1-305:0| BL:SWS:NREP 1 BL:SWS:REP 7->276|ILVE_METJA|2e-20|28.9|249/288| BL:PDB:NREP 1 BL:PDB:REP 10->276|1daaA|7e-14|26.3|247/277| RP:PDB:NREP 1 RP:PDB:REP 9->299|1a0gB|8e-43|21.3|272/282| RP:PFM:NREP 1 RP:PFM:REP 48->276|PF01063|5e-20|36.2|207/220|Aminotran_4| HM:PFM:NREP 1 HM:PFM:REP 48->281|PF01063|5.6e-40|33.2|214/232|Aminotran_4| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01063|IPR001544| GO:PFM GO:0008152|"GO:metabolic process"|PF01063|IPR001544| RP:SCP:NREP 1 RP:SCP:REP 6->293|1et0A|3e-40|17.3|254/254|e.17.1.1| HM:SCP:REP 5->297|1daaA_|8.4e-59|30.4|273/277|e.17.1.1|1/1|D-aminoacid aminotransferase-like PLP-dependent enzymes| OP:NHOMO 356 OP:NHOMOORG 283 OP:PATTERN -----------------------1-----1-1---1111111111-1111---1------------1- --1-111111111111111-11--1111111111111111----21111--111111111111111111111-------------1---------------------11-------------------------------------1--1-----111-1-1---11-----1-----1--1---------1113333333313333331-221-333111----111111-1------------------------------------------------------------------------------------------1---------------------------1--1233--1111111111-----1---------12----1--1-------------2-------1-212-12211--1--111111---111-1--111111111-11---11-----------------------------------1222111111111111111-1111111-1111---1211--------1----12-----------11-1-11-3111----1-------------1-1--1-1--1-------------------------11111--1-1------------1---------2122--------23----------------------------------1-22111-----------------------------------------1111111111-111--------------------------1---------------1-----------2----------1-----------------1----------------------------------------------1--------11- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------7------111-31------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 304 STR:RPRED 99.7 SQ:SECSTR #EETTcEEETTEEEEGGGccccTTcHHHHTccEEEEEEEEETTEETTHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHTcccEEEEEEEEccccccccccccTTcccEEEEEEEEcccEEEEEEEcccccccTTcccHHHHHHcEEEEEEEccccccTTccccccHHHHHHHHHHHHTTccEEEEEcETTEEEEEcccEEEEEETTEEEEccccTTccccHHHHHHHHHHHHTTccEEcccccHHHHTTccEEEEEETTTEEEEEEEETTEEcTTccccHHHHHHHHHTTcccccccTT DISOP:02AL 1-2, 300-305| PSIPRED ccccEEEEEccEEEcHHccccccccHHHHHcHHHEEEEEEEccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccEEEEEEEEcccccccccccccccccccccccccEEEEEEEEcccccHHHHHcccEEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHccccEEEEEcccccEEEEEcEEEEEEEccEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHEEEEcccEEEEEEEEEccEEcccccHHHHHHHHHHHHHHcccccccc //