[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55431.1
DDBJ      :             putative cytochrome D ubiquinol oxidase subunit II
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  539/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:343 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->322 PF02322 * Cyto_ox_2 6e-53 41.0 %
:HMM:PFM   3->322 PF02322 * Cyto_ox_2 3.3e-116 48.3 319/328  
:BLT:SWISS 7->189,268->330 CYDB_ECOLI 6e-38 42.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55431.1 GT:GENE BAD55431.1 GT:PRODUCT putative cytochrome D ubiquinol oxidase subunit II GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 606910..607941 GB:FROM 606910 GB:TO 607941 GB:DIRECTION + GB:PRODUCT putative cytochrome D ubiquinol oxidase subunit II GB:PROTEIN_ID BAD55431.1 LENGTH 343 SQ:AASEQ MSLAEFWFVLIGVLFTGYFVLEGFDFGVGMLMPVLGKGSDARRRAVLNTIGPVWDGNEVWLITAGGALFAAFPEWYASMFSGFYLALLLVLVALILRICAIEYRGKIDDPRWRARCDIGIGIGSWVPAFAWGWVFANIVRGVPLDADKQLVGSIGDLFSPYALLGALATGLLFALHGAIFLGLKTGGDVRADAVRVAKLLLGPAALVVGGFGLWTQLAYGADWTWIPLGVAVIGLVGAAAAVFADRDGWAFAGTALTVAAATVLLFGSLFPNVLPSTISDAFSLTVDNASSTPYTLKVMSWAAVVVTPVVLGYQAWTYWVFRKRISVEHIPAPVGLTPRPDKD GT:EXON 1|1-343:0| BL:SWS:NREP 1 BL:SWS:REP 7->189,268->330|CYDB_ECOLI|6e-38|42.9|245/379| TM:NTM 9 TM:REGION 9->31| TM:REGION 55->77| TM:REGION 80->102| TM:REGION 119->141| TM:REGION 157->179| TM:REGION 192->214| TM:REGION 225->244| TM:REGION 250->272| TM:REGION 296->318| SEG 85->96|lalllvlvalil| SEG 162->178|allgalatgllfalhga| SEG 196->213|vaklllgpaalvvggfgl| SEG 229->267|gvaviglvgaaaavfadrdgwafagtaltvaaatvllfg| RP:PFM:NREP 1 RP:PFM:REP 7->322|PF02322|6e-53|41.0|315/328|Cyto_ox_2| HM:PFM:NREP 1 HM:PFM:REP 3->322|PF02322|3.3e-116|48.3|319/328|Cyto_ox_2| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF02322|IPR003317| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02322|IPR003317| OP:NHOMO 801 OP:NHOMOORG 547 OP:PATTERN -------------------------421-1--------------------11-----1---------- 1111--11111--111111-11--1111111111111111111-11111111111-11--11111111112--------111-11-11------------11--------11111111111111111-11-11-11--------1-1111---1111-------11141---------------1------111222222221222222--1111222-------1111111---------------------1-1-22-11-1111122-1-1111111111---------------------------------------1----------------------------1--1-11-1----11--------11111-------221-1-1-1-2-11111111111-22223-231-1-3111-111111131-1---111111--2222222221111-21------------11---111111111-1---12-1222133332333222255533333124542221--112-2---11111-11--2-211----------11--111111112111111-11111111111--13-------------------------11221211211121222211121221111211--1-11-------22112222222222122-2222222222222222222322223232222222222222221222222221-211111111111----1211222221-11211111111111111122222121112111212222112112111111111111-111133333122112234344322-------------------------------------------------------------11 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 333-343| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccEEccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEccccHHHcccccccccccccc //