[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55435.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->38 PF05685 * DUF820 3.7e-07 38.9 36/111  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55435.1 GT:GENE BAD55435.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 611877..612116 GB:FROM 611877 GB:TO 612116 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55435.1 LENGTH 79 SQ:AASEQ MSPDSEERDRETKPLKYANAGIPHFWRVERGSDDRVVVYVYELDRVSARYVPIGIFHDRLKLPVPFPVDIDLEALGRRG GT:EXON 1|1-79:0| HM:PFM:NREP 1 HM:PFM:REP 2->38|PF05685|3.7e-07|38.9|36/111|DUF820| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1-----1-------------------------12----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 78-79| PSIPRED cccccccccccccccccccccccEEEEEEcccccEEEEEEEEcccccccEEEEEEEEEEEEccccccccccHHcccccc //