[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55437.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:50 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   21->40 PF11395 * DUF2873 0.00067 50.0 20/43  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55437.1 GT:GENE BAD55437.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(612839..612991) GB:FROM 612839 GB:TO 612991 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55437.1 LENGTH 50 SQ:AASEQ MGCRGAVSLPGTEVDRLGCVVLFFEILLVLVSLLIGWFGLYVFYRLFTES GT:EXON 1|1-50:0| TM:NTM 1 TM:REGION 17->39| SEG 20->35|vvlffeillvlvslli| HM:PFM:NREP 1 HM:PFM:REP 21->40|PF11395|0.00067|50.0|20/43|DUF2873| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 6-7| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //