[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55438.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.3.2b.3.7
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->74 1ujwA PDBj 5e-04 39.1 %
:RPS:PDB   23->100 3cbrB PDBj 4e-05 19.5 %
:RPS:SCOP  4->97 1xpnA  b.3.7.1 * 4e-07 14.9 %
:HMM:SCOP  22->74 1uwyA1 b.3.2.1 * 1.8e-06 35.3 %
:RPS:PFM   17->100 PF07210 * DUF1416 4e-25 70.2 %
:HMM:PFM   14->99 PF07210 * DUF1416 3.2e-43 70.6 85/86  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55438.1 GT:GENE BAD55438.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(613037..613342) GB:FROM 613037 GB:TO 613342 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55438.1 LENGTH 101 SQ:AASEQ MCAAPTQGQAIPAGVDVEKETVITGRVLASDGQPVGGAFVRLLDGNGDFTAEVVASGTGDFRFFAAPGTWTVRALSSAGNGSAEVRPEGAGIHTVDVAVAK GT:EXON 1|1-101:0| BL:PDB:NREP 1 BL:PDB:REP 10->74|1ujwA|5e-04|39.1|64/576| RP:PDB:NREP 1 RP:PDB:REP 23->100|3cbrB|4e-05|19.5|77/97| RP:PFM:NREP 1 RP:PFM:REP 17->100|PF07210|4e-25|70.2|84/87|DUF1416| HM:PFM:NREP 1 HM:PFM:REP 14->99|PF07210|3.2e-43|70.6|85/86|DUF1416| RP:SCP:NREP 1 RP:SCP:REP 4->97|1xpnA|4e-07|14.9|94/170|b.3.7.1| HM:SCP:REP 22->74|1uwyA1|1.8e-06|35.3|51/0|b.3.2.1|1/1|Carboxypeptidase regulatory domain-like| OP:NHOMO 46 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- ----1---------11111-111111222221111111121111----------------111-1111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 89.1 SQ:SECSTR #########EEEEEEEEEEEEEEEEEEETTTTEEccccEEEEEcccEEEEEEEEccTTcEEccccccEEEEEEE#EccccccEEEEEEEcccEEEEEEEE# DISOP:02AL 1-9| PSIPRED ccccccccccccccccccccEEEEEEEEcccccccccEEEEEEcccccEEEEEEEcccccEEEEEccccEEEEEEEccccccEEEEcccccEEEEEEEEEc //