[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55440.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:162 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->64 PF01036 * Bac_rhodopsin 0.00018 20.8 48/233  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55440.1 GT:GENE BAD55440.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(614211..614699) GB:FROM 614211 GB:TO 614699 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55440.1 LENGTH 162 SQ:AASEQ MSTTSTTAEADGAVDRVDVRGPRFVAWITTAVLVLVLLAAAVSPGLAAVLIAVQAVVFAIGALAGPRRHPYGLVFAALVAPRLGPVRETEPTPPLRFAQLLGFVFAAVSLLGFVLGSTVVGAVFAGFALFAAFLNAAFGLCLGCRIYPLVARFRPAGSPASN GT:EXON 1|1-162:0| TM:NTM 3 TM:REGION 35->57| TM:REGION 94->116| TM:REGION 124->146| SEG 31->60|avlvlvllaaavspglaavliavqavvfai| SEG 119->140|vvgavfagfalfaaflnaafgl| HM:PFM:NREP 1 HM:PFM:REP 13->64|PF01036|0.00018|20.8|48/233|Bac_rhodopsin| OP:NHOMO 21 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- --------------111----11121-----2111111-2-------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 7-8, 158-162| PSIPRED cccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //