[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55454.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:198 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   9->90 2drrA PDBj 5e-04 13.4 %
:HMM:PFM   4->132 PF06078 * DUF937 2.1e-22 37.8 119/137  
:BLT:SWISS 1->74 Y1999_CORGL 7e-04 37.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55454.1 GT:GENE BAD55454.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(629108..629704) GB:FROM 629108 GB:TO 629704 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55454.1 LENGTH 198 SQ:AASEQ MTSFDELLSNVPISQIAEKLGVDESTTRTAVQAALPTLLGGLQANAAEPAGATALVGALDKHDPGLVEGQGAVDIAQVDVADGAKIVDKVFGAEKNTVISALGSTAGTGGNDLVAQLLPILAPIVLAYLAKQLTGGAAAPQAPAPAPTPSAGGAIGDILGGLLGGGKGGIGGAIGEAIAKNAGGALGNVLGGLLGGKR GT:EXON 1|1-198:0| BL:SWS:NREP 1 BL:SWS:REP 1->74|Y1999_CORGL|7e-04|37.0|73/100| SEG 135->196|ggaaapqapapaptpsaggaigdilggllgggkggiggaigeaiaknaggalgnvlggllgg| RP:PDB:NREP 1 RP:PDB:REP 9->90|2drrA|5e-04|13.4|82/376| HM:PFM:NREP 1 HM:PFM:REP 4->132|PF06078|2.1e-22|37.8|119/137|DUF937| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- --------------1------1--1------11---1111--------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1------------------------------------------------------------1-------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 41.4 SQ:SECSTR ########HHcccccHHHHTTccHHHHHHHHHHHHHHHHcccTTTccEEEETTTEEEEccTTTTcEEHHHHHHHHHHHHHTTcHHHHHHH############################################################################################################ DISOP:02AL 6-7, 98-112, 135-147, 160-170, 197-198| PSIPRED ccHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHcccc //