[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55456.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.218.1
:211 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   94->144 3c66B PDBj 6e-05 18.4 %
:RPS:SCOP  92->174 1no5A  d.218.1.5 * 5e-05 20.3 %
:HMM:SCOP  77->210 1knyA2 d.218.1.1 * 6.5e-13 28.0 %
:HMM:PFM   101->138 PF01909 * NTP_transf_2 1.5e-07 33.3 33/93  
:HMM:PFM   17->75 PF03965 * Pencillinase_R 2.7e-06 20.7 58/115  
:BLT:SWISS 46->93 SYR_METMP 2e-04 51.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55456.1 GT:GENE BAD55456.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 632072..632707 GB:FROM 632072 GB:TO 632707 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55456.1 LENGTH 211 SQ:AASEQ MQLNKPFATVTPTLDGDVLAVLASADAAFTISQVRRILDNASGEGIRKVLNRLVVQGVVLHDEVGRTHTYRLNTEHLATEAILALARLNSTFLRRLEQHLEGWGTSLRYAAVFGSAATGRMRLDSDIDLFLVRAVDSGDDDYAWGQRVTELARLVTAWTGNDGRIVEYAEDEFRAAVAAGEPLLHDVAKQGLTVAGTRAWLNAQLRPVRRS GT:EXON 1|1-211:0| BL:SWS:NREP 1 BL:SWS:REP 46->93|SYR_METMP|2e-04|51.2|43/100| SEG 14->28|ldgdvlavlasadaa| RP:PDB:NREP 1 RP:PDB:REP 94->144|3c66B|6e-05|18.4|49/529| HM:PFM:NREP 2 HM:PFM:REP 101->138|PF01909|1.5e-07|33.3|33/93|NTP_transf_2| HM:PFM:REP 17->75|PF03965|2.7e-06|20.7|58/115|Pencillinase_R| RP:SCP:NREP 1 RP:SCP:REP 92->174|1no5A|5e-05|20.3|79/100|d.218.1.5| HM:SCP:REP 77->210|1knyA2|6.5e-13|28.0|125/0|d.218.1.1|1/1|Nucleotidyltransferase| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ------------------------1------1----1--2----------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 49 STR:RPRED 23.2 SQ:SECSTR #############################################################################################TTccHHHHHHTccEEEE##EHHHHHTcccccccEEEEEEEcTTccHHHHTT################################################################### DISOP:02AL 1-4, 209-211| PSIPRED cccccccEEEccccccHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHEEcccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEHHHccccccccEEEccccEEEEEEEEccccccHHHHHHHHHHHHHHHHEEcccccEEEEcHHHHHHHHHcccHHHHHHHHcccEEEEHHHHHcccccccccc //