[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55457.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   53->113 PF06089 * Asparaginase_II 0.00071 21.3 61/325  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55457.1 GT:GENE BAD55457.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 632704..633093 GB:FROM 632704 GB:TO 633093 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55457.1 LENGTH 129 SQ:AASEQ MMAGQRSCDSAVTAGRMFKANEFFDAAEHLGEEMPNAAGDLYVDAGIAASDVICCVRLGVHSNTGNHSEAVALLKRADSGSERHLNTLLNLKNKAAYTHQGLTAAELKKMNRAADYLVEVAKKAVAARG GT:EXON 1|1-129:0| SEG 85->94|lntllnlknk| HM:PFM:NREP 1 HM:PFM:REP 53->113|PF06089|0.00071|21.3|61/325|Asparaginase_II| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------1------11---1--2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccc //