[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55459.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:307 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   99->129 PF11293 * DUF3094 0.00056 46.7 30/55  
:HMM:PFM   79->94 PF12537 * DUF3735 0.00048 50.0 16/71  
:HMM:PFM   260->300 PF07938 * Fungal_lectin 0.00038 34.1 41/311  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55459.1 GT:GENE BAD55459.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 634103..635026 GB:FROM 634103 GB:TO 635026 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55459.1 LENGTH 307 SQ:AASEQ MADEPAPVRDNATFAGLSQVAHVVGQFVAPATLLAGLLFYWGFFHARGFCGYLGVKSDVLGLSTTDYVMRSADGLFVPLAVVGVTALALLWGWGVLPNRVRRAPWPPWLLVVLAGLAVLLIANGASRLLFEWWGNRRLAVAPACLIAGVLLLRVVVRARQSPLHRADGERGAVDRSVAPLEWGLVLLLVGGAFFWGATDYSMAVGTGRAATYIAERLANEPGVTVYSEKNLELAVPDVTATACADPAAAYRYRYEGLVLVMSTADNFVLLPRTWKPDTGTAVVLPRSGIGATRVEYSGTDAGPRPAC GT:EXON 1|1-307:0| TM:NTM 5 TM:REGION 18->40| TM:REGION 73->95| TM:REGION 104->126| TM:REGION 138->157| TM:REGION 173->195| SEG 77->90|vplavvgvtalall| SEG 103->120|apwppwllvvlaglavll| SEG 149->159|vlllrvvvrar| SEG 182->197|wglvlllvggaffwga| SEG 236->249|pdvtatacadpaaa| HM:PFM:NREP 3 HM:PFM:REP 99->129|PF11293|0.00056|46.7|30/55|DUF3094| HM:PFM:REP 79->94|PF12537|0.00048|50.0|16/71|DUF3735| HM:PFM:REP 260->300|PF07938|0.00038|34.1|41/311|Fungal_lectin| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 164-167, 301-302, 304-307| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHcccccHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHcccEEEEHHHHHHHHHHHHHHHHHHHcccHHHccccccccccccccHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHcccccEEEEEccccEEEcccccHHHHccHHHHHHEEEccEEEEEEccccEEEEccccccccccEEEEEccccccEEEEEccccccccccc //