[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55460.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:61 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->43 PF05036 * SPOR 1.5e-05 30.0 30/76  
:BLT:SWISS 7->54 CSLF6_ORYSJ 7e-04 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55460.1 GT:GENE BAD55460.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 635128..635313 GB:FROM 635128 GB:TO 635313 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55460.1 LENGTH 61 SQ:AASEQ MDERWYYCLKHQRAEQGRQCWFRDRMGPYPDRATAERALEIARARNEYEDARDRAWREGDR GT:EXON 1|1-61:0| BL:SWS:NREP 1 BL:SWS:REP 7->54|CSLF6_ORYSJ|7e-04|33.3|48/100| HM:PFM:NREP 1 HM:PFM:REP 14->43|PF05036|1.5e-05|30.0|30/76|SPOR| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1-11------------------------1---11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 57-61| PSIPRED ccccEEEEccccEEcccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHccccccc //