[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55467.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  221/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.152.1
:157 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   39->146 2gmyD PDBj 1e-16 34.9 %
:RPS:PDB   24->155 3c1lC PDBj 2e-20 20.2 %
:RPS:SCOP  2->147 2gmyA1  a.152.1.3 * 4e-24 28.9 %
:HMM:SCOP  3->149 2o4dA1 a.152.1.3 * 4.4e-36 36.1 %
:RPS:PFM   37->80 PF02627 * CMD 4e-05 38.6 %
:HMM:PFM   23->96 PF02627 * CMD 2.8e-22 37.0 73/85  
:BLT:SWISS 29->142 YDFG_BACSU 2e-18 34.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55467.1 GT:GENE BAD55467.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 644416..644889 GB:FROM 644416 GB:TO 644889 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55467.1 LENGTH 157 SQ:AASEQ MEQRFDFMGQQAGAKFIKRINNAGMVVGETTLPRSTQELVLLRVSQVNGCGFCVDMHYKDAVHEGEDPVRLNLVAAWREATVFTEAERAALAFAEESARLADAHQGVSDETWAQVRKHYDDDQIAGLIMVVALINAYNRINVVTRTPAGGYVPGQFA GT:EXON 1|1-157:0| BL:SWS:NREP 1 BL:SWS:REP 29->142|YDFG_BACSU|2e-18|34.8|112/147| SEG 85->101|eaeraalafaeesarla| BL:PDB:NREP 1 BL:PDB:REP 39->146|2gmyD|1e-16|34.9|106/145| RP:PDB:NREP 1 RP:PDB:REP 24->155|3c1lC|2e-20|20.2|124/175| RP:PFM:NREP 1 RP:PFM:REP 37->80|PF02627|4e-05|38.6|44/83|CMD| HM:PFM:NREP 1 HM:PFM:REP 23->96|PF02627|2.8e-22|37.0|73/85|CMD| RP:SCP:NREP 1 RP:SCP:REP 2->147|2gmyA1|4e-24|28.9|142/147|a.152.1.3| HM:SCP:REP 3->149|2o4dA1|4.4e-36|36.1|144/0|a.152.1.3|1/1|AhpD-like| OP:NHOMO 351 OP:NHOMOORG 222 OP:PATTERN -------------------------------------------------------------------- 12--5--1111---2------1---2------22222134-212--------1-1-11---21-1-3462------------1------------------3---212-2------------------------------------1-------------------1--------------------------------------------11-1--2---1---------12-------------------1------------------------------------------------------------------------------------------------------------------------1-----1-----2-5111-21-11-----------1-11--11--121-211-332353211------11-11-11-------------1----------------------------------11--33223322232111133342222123213453--33----221-2-42-2-----2----------14---------------------1----111122---------------------------111---1--11--11111--11111--1-11--------------11---1--111-111---1---111-1-111-----1111211--1-111111111111111--1------1--------------------------1-1---------------------------111111311-1121----------------1-------11-22---------------------------------------------------------------------2- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 98.7 SQ:SECSTR ccHHHHHGGGcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHccHHHHHHHHGGGcccHHHHHccHHHHHHHHHHHHHHcGGGccHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHTcccGGGTTTc## DISOP:02AL 151-157| PSIPRED ccccccHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //