[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55469.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:175 amino acids
:PSIPRED
:RPS:PDB   8->30 1aqjB PDBj 4e-04 21.7 %
:HMM:SCOP  8->164 1vl5A_ c.66.1.41 * 3.5e-22 29.0 %
:HMM:PFM   22->128 PF08242 * Methyltransf_12 1.1e-10 34.0 97/99  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55469.1 GT:GENE BAD55469.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 646255..646782 GB:FROM 646255 GB:TO 646782 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55469.1 LENGTH 175 SQ:AASEQ MGDERFGWFAEMLDLGEGDLVLEIGPGSGASLGELARRLVRGRVVGIDRSATAVDRAARRYAAAIESGRITVAHLDFRALDAGRVRADFDAPAGFDRILAVNVNLFWTTRASAELALIRALLAPGGSLLLGYGYGVVSEGPVPSADRLVEHLAAAGFRSEVRTRGALLAVRARPS GT:EXON 1|1-175:0| SEG 32->46|lgelarrlvrgrvvg| SEG 51->64|atavdraarryaaa| SEG 120->138|allapggslllgygygvvs| RP:PDB:NREP 1 RP:PDB:REP 8->30|1aqjB|4e-04|21.7|23/383| HM:PFM:NREP 1 HM:PFM:REP 22->128|PF08242|1.1e-10|34.0|97/99|Methyltransf_12| HM:SCP:REP 8->164|1vl5A_|3.5e-22|29.0|145/0|c.66.1.41|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHccccccEEEcccEEEcccHHccccccccccEEEEEEEHHHHcccccHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHcccccccHHccccEEcccccc //