[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55470.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->35 PF11021 * DUF2613 0.00085 32.0 25/56  
:REPEAT 3|33->43|44->54|60->72

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55470.1 GT:GENE BAD55470.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(646852..647070) GB:FROM 646852 GB:TO 647070 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55470.1 LENGTH 72 SQ:AASEQ MAAYLDLLLHPAASEVAGTVLGLVREVAHDLIAGTGDWFTGSSTGDAGLGSSTPDGGVGSSTGDWFTGSSYP GT:EXON 1|1-72:0| NREPEAT 1 REPEAT 3|33->43|44->54|60->72| HM:PFM:NREP 1 HM:PFM:REP 11->35|PF11021|0.00085|32.0|25/56|DUF2613| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 71-72| PSIPRED cHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccc //