[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55473.1
DDBJ      :             putative translocator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  88/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:246 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   138->188 PF01810 * LysE 1e-05 45.1 %
:HMM:PFM   47->239 PF01810 * LysE 3.3e-26 25.8 190/192  
:BLT:SWISS 144->186 RHTB_SALTY 4e-04 47.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55473.1 GT:GENE BAD55473.1 GT:PRODUCT putative translocator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(649264..650004) GB:FROM 649264 GB:TO 650004 GB:DIRECTION - GB:PRODUCT putative translocator GB:PROTEIN_ID BAD55473.1 LENGTH 246 SQ:AASEQ MLGPDMRGPGMRGPAMSDWTETGTTGPGQDRDMIESAAVLGVAAAALAMVLTPGPNMMYLVSRTVAQGRRAGLVSLGGVAAGFAVYLAAATAGLTAVFALVPGLYLAVKLAGAAYLLWLAWRALRPGGASVFEPADLPADPARRLFTMGLVTNLLNPKIAVMYMALIPQFVVPARGHLWLQSLSLGAVQITVALAVNALIVLGTGTLVAFLTRRPAWLRTQRYLMGTALAGVAVALVTDRTRPTPA GT:EXON 1|1-246:0| BL:SWS:NREP 1 BL:SWS:REP 144->186|RHTB_SALTY|4e-04|47.6|42/206| TM:NTM 6 TM:REGION 33->55| TM:REGION 72->94| TM:REGION 98->120| TM:REGION 148->170| TM:REGION 186->208| TM:REGION 218->238| SEG 1->16|mlgpdmrgpgmrgpam| SEG 37->51|aavlgvaaaalamvl| SEG 71->101|aglvslggvaagfavylaaatagltavfalv| SEG 110->125|lagaayllwlawralr| SEG 226->238|gtalagvavalvt| RP:PFM:NREP 1 RP:PFM:REP 138->188|PF01810|1e-05|45.1|51/190|LysE| HM:PFM:NREP 1 HM:PFM:REP 47->239|PF01810|3.3e-26|25.8|190/192|LysE| GO:PFM:NREP 2 GO:PFM GO:0006865|"GO:amino acid transport"|PF01810|IPR001123| GO:PFM GO:0016020|"GO:membrane"|PF01810|IPR001123| OP:NHOMO 105 OP:NHOMOORG 88 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1111-1-------------------1----2--1---------------------------------------1---------------------------------------------------------------------------1-------------1-------------------1-----------1------------------------------------------------------------------------------------------------------------------------------------------------111--------1--11-------------------1-11111-1--1111--21--11-------1----1-----------11-----------------------------------------11-1333233-----1122------211---1--111-------1-21--1--------------------1--------------1--1-----------------------------------------1------------------------------------------11--1-------------------------------1--1--------------------------------------------------------------------------1111111---------1111-111-----------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18, 126-144, 244-246| PSIPRED cccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //